{ "glytoucan_ac": "G02528FI", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mass": 2370.88, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 5, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 5, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 4, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLnSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLNSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "N", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALnLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALNLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "N", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "763", "site_seq": "EALNnASSLFEQWLNGTVSLPVNLR", "site_lbl": "Asn763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 763, "end_pos": 763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "763", "site_seq": "N", "site_lbl": "Asn763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 763, "end_pos": 763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLnSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLNSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "N", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALnLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALNLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "N", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "763", "site_seq": "EALNnASSLFEQWLNGTVSLPVNLR", "site_lbl": "Asn763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 763, "end_pos": 763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "763", "site_seq": "N", "site_lbl": "Asn763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 763, "end_pos": 763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLnSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLNSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "N", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALnLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALNLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "N", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "763", "site_seq": "EALNnASSLFEQWLNGTVSLPVNLR", "site_lbl": "Asn763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 763, "end_pos": 763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "763", "site_seq": "N", "site_lbl": "Asn763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 763, "end_pos": 763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "", "site_lbl": "N324", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "4", "chr_pos": "110506688", "evidence": [ { "id": "rs1357172069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357172069" }, { "id": "rs1357172069", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357172069" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "", "site_lbl": "N607", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "4", "chr_pos": "110542764", "evidence": [ { "id": "rs773384440", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773384440" }, { "id": "rs773384440", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773384440" }, { "id": "rs773384440", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773384440#frequency_tab" }, { "id": "rs773384440", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773384440" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "", "site_lbl": "N678", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "4", "chr_pos": "110548207", "evidence": [ { "id": "rs1727151705", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727151705" }, { "id": "rs1727151705", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727151705" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "763", "site_seq": "", "site_lbl": "N763", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->DAS).", "chr_id": "4", "chr_pos": "110549589", "evidence": [ { "id": "rs1337149476", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1337149476" }, { "id": "rs1337149476", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1337149476#frequency_tab" }, { "id": "rs1337149476", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1337149476" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 763, "end_pos": 763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLnSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLNSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "N", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALnLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "VALNLTK", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "N", "site_lbl": "Asn678", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "763", "site_seq": "EALNnASSLFEQWLNGTVSLPVNLR", "site_lbl": "Asn763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 763, "end_pos": 763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "763", "site_seq": "N", "site_lbl": "Asn763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 763, "end_pos": 763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "", "site_lbl": "N324", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "4", "chr_pos": "110506688", "evidence": [ { "id": "rs1357172069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357172069" }, { "id": "rs1357172069", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357172069" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "", "site_lbl": "N607", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "4", "chr_pos": "110542764", "evidence": [ { "id": "rs773384440", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773384440" }, { "id": "rs773384440", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773384440" }, { "id": "rs773384440", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773384440#frequency_tab" }, { "id": "rs773384440", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773384440" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "678", "site_seq": "", "site_lbl": "N678", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "4", "chr_pos": "110548207", "evidence": [ { "id": "rs1727151705", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727151705" }, { "id": "rs1727151705", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727151705" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 678, "end_pos": 678, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "763", "site_seq": "", "site_lbl": "N763", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->DAS).", "chr_id": "4", "chr_pos": "110549589", "evidence": [ { "id": "rs1337149476", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1337149476" }, { "id": "rs1337149476", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1337149476#frequency_tab" }, { "id": "rs1337149476", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1337149476" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 763, "end_pos": 763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYnLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYNLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYnLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYNLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYnLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYNLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "", "site_lbl": "N121", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "13", "chr_pos": "113309820", "evidence": [ { "id": "rs1483329400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1483329400" }, { "id": "rs1483329400", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1483329400#frequency_tab" }, { "id": "rs1483329400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1483329400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "", "site_lbl": "N261", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "13", "chr_pos": "113320377", "evidence": [ { "id": "rs749315723", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749315723" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "13", "chr_pos": "113320376", "evidence": [ { "id": "rs1469959940", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469959940" }, { "id": "rs1469959940", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1469959940#frequency_tab" }, { "id": "rs1469959940", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1469959940" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "", "site_lbl": "N84", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->TTS).", "chr_id": "13", "chr_pos": "113309710", "evidence": [ { "id": "rs762446154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762446154#frequency_tab" }, { "id": "rs762446154", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762446154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYnLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "YSVQLMSFVYNLSDTHLFPNASSK", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "121", "site_seq": "", "site_lbl": "N121", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "13", "chr_pos": "113309820", "evidence": [ { "id": "rs1483329400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1483329400" }, { "id": "rs1483329400", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1483329400#frequency_tab" }, { "id": "rs1483329400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1483329400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "", "site_lbl": "N261", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "13", "chr_pos": "113320377", "evidence": [ { "id": "rs749315723", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749315723" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "13", "chr_pos": "113320376", "evidence": [ { "id": "rs1469959940", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469959940" }, { "id": "rs1469959940", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1469959940#frequency_tab" }, { "id": "rs1469959940", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1469959940" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "", "site_lbl": "N84", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->TTS).", "chr_id": "13", "chr_pos": "113309710", "evidence": [ { "id": "rs762446154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762446154#frequency_tab" }, { "id": "rs762446154", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762446154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "250", "site_seq": "DPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSNVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "GPCGSRDPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSNVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "GPCGSRDPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSNVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "GPCGSRDPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSNVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "GPCGSRDPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "", "site_lbl": "N1223", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "1", "chr_pos": "183132500", "evidence": [ { "id": "rs892534215", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs892534215" }, { "id": "rs892534215", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs892534215#frequency_tab" }, { "id": "rs892534215", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs892534215" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "1", "chr_pos": "183132502", "evidence": [ { "id": "rs1571463550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1571463550" }, { "id": "rs1571463550", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1571463550#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "", "site_lbl": "N1241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "P11047", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P11047" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "", "site_lbl": "N1223", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "1", "chr_pos": "183132500", "evidence": [ { "id": "rs892534215", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs892534215" }, { "id": "rs892534215", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs892534215#frequency_tab" }, { "id": "rs892534215", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs892534215" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "1", "chr_pos": "183132502", "evidence": [ { "id": "rs1571463550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1571463550" }, { "id": "rs1571463550", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1571463550#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "", "site_lbl": "N1241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "P11047", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P11047" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "67", "site_seq": "GHEVTVLASSASILFDPnNSSALK", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "N", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "GHEVTVLASSASILFDPnNSSALK", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "N", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "GHEVTVLASSASILFDPnNSSALK", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "N", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "", "site_lbl": "N67", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "4", "chr_pos": "69096719", "evidence": [ { "id": "rs748435925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748435925" }, { "id": "rs748435925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748435925" }, { "id": "rs748435925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748435925" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "GHEVTVLASSASILFDPnNSSALK", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "N", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "", "site_lbl": "N67", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "4", "chr_pos": "69096719", "evidence": [ { "id": "rs748435925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748435925" }, { "id": "rs748435925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748435925" }, { "id": "rs748435925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748435925" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1802", "site_seq": "EGnATGHLVGR", "site_lbl": "Asn1802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 1802, "end_pos": 1802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1802", "site_seq": "N", "site_lbl": "Asn1802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 1802, "end_pos": 1802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3125", "site_seq": "SSnNSMLLVFK", "site_lbl": "Asn3125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3125, "end_pos": 3125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3125", "site_seq": "N", "site_lbl": "Asn3125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3125, "end_pos": 3125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "GSFTSPGYPGTYPnNTYCEWVLVAPAGR", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "N", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1802", "site_seq": "EGnATGHLVGR", "site_lbl": "Asn1802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 1802, "end_pos": 1802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1802", "site_seq": "N", "site_lbl": "Asn1802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 1802, "end_pos": 1802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3125", "site_seq": "SSnNSMLLVFK", "site_lbl": "Asn3125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3125, "end_pos": 3125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3125", "site_seq": "N", "site_lbl": "Asn3125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3125, "end_pos": 3125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "GSFTSPGYPGTYPnNTYCEWVLVAPAGR", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "N", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1802", "site_seq": "EGnATGHLVGR", "site_lbl": "Asn1802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 1802, "end_pos": 1802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1802", "site_seq": "N", "site_lbl": "Asn1802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 1802, "end_pos": 1802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3125", "site_seq": "SSnNSMLLVFK", "site_lbl": "Asn3125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3125, "end_pos": 3125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3125", "site_seq": "N", "site_lbl": "Asn3125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3125, "end_pos": 3125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "GSFTSPGYPGTYPnNTYCEWVLVAPAGR", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "N", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "10", "chr_pos": "17127864", "evidence": [ { "id": "rs2492161163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2492161163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1802", "site_seq": "", "site_lbl": "N1802", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "10", "chr_pos": "16940174", "evidence": [ { "id": "rs1842615728", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1842615728" }, { "id": "rs1842615728", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1842615728#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "10", "chr_pos": "16940175", "evidence": [ { "id": "rs765059540", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765059540" }, { "id": "rs765059540", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765059540" }, { "id": "rs765059540", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765059540" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 1802, "end_pos": 1802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "", "site_lbl": "N2531", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "10", "chr_pos": "16907620", "evidence": [ { "id": "rs555761842", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs555761842" }, { "id": "rs555761842", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs555761842" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3125", "site_seq": "", "site_lbl": "N3125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "10", "chr_pos": "16869716", "evidence": [ { "id": "rs1840293875", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1840293875" }, { "id": "rs1840293875", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1840293875" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->YNS).", "chr_id": "10", "chr_pos": "16869717", "evidence": [ { "id": "rs756429821", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756429821" }, { "id": "rs756429821", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756429821" }, { "id": "rs756429821", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756429821" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3125, "end_pos": 3125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "", "site_lbl": "N3533", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "10", "chr_pos": "16828972", "evidence": [ { "id": "rs1838882476", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1838882476" }, { "id": "rs1838882476", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1838882476#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "", "site_lbl": "N781", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "10", "chr_pos": "17071930", "evidence": [ { "id": "rs149758972", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149758972#frequency_tab" }, { "id": "rs149758972", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149758972" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1802", "site_seq": "EGnATGHLVGR", "site_lbl": "Asn1802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 1802, "end_pos": 1802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1802", "site_seq": "N", "site_lbl": "Asn1802", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 1802, "end_pos": 1802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3125", "site_seq": "SSnNSMLLVFK", "site_lbl": "Asn3125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3125, "end_pos": 3125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3125", "site_seq": "N", "site_lbl": "Asn3125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3125, "end_pos": 3125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "GSFTSPGYPGTYPnNTYCEWVLVAPAGR", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "N", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "10", "chr_pos": "17127864", "evidence": [ { "id": "rs2492161163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2492161163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1802", "site_seq": "", "site_lbl": "N1802", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "10", "chr_pos": "16940174", "evidence": [ { "id": "rs1842615728", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1842615728" }, { "id": "rs1842615728", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1842615728#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "10", "chr_pos": "16940175", "evidence": [ { "id": "rs765059540", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765059540" }, { "id": "rs765059540", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765059540" }, { "id": "rs765059540", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765059540" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 1802, "end_pos": 1802, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "", "site_lbl": "N2531", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "10", "chr_pos": "16907620", "evidence": [ { "id": "rs555761842", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs555761842" }, { "id": "rs555761842", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs555761842" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3125", "site_seq": "", "site_lbl": "N3125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "10", "chr_pos": "16869716", "evidence": [ { "id": "rs1840293875", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1840293875" }, { "id": "rs1840293875", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1840293875" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->YNS).", "chr_id": "10", "chr_pos": "16869717", "evidence": [ { "id": "rs756429821", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756429821" }, { "id": "rs756429821", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756429821" }, { "id": "rs756429821", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756429821" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3125, "end_pos": 3125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "", "site_lbl": "N3533", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "10", "chr_pos": "16828972", "evidence": [ { "id": "rs1838882476", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1838882476" }, { "id": "rs1838882476", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1838882476#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "", "site_lbl": "N781", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "10", "chr_pos": "17071930", "evidence": [ { "id": "rs149758972", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149758972#frequency_tab" }, { "id": "rs149758972", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149758972" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "FVGTPEVnQTTLYQR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "FVGTPEVNQTTLYQR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "FVGTPEVnQTTLYQR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "FVGTPEVNQTTLYQR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "FVGTPEVnQTTLYQR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "FVGTPEVNQTTLYQR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "FVGTPEVnQTTLYQR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "53", "site_seq": "FVGTPEVNQTTLYQR", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "", "site_lbl": "N57", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "16", "chr_pos": "89635973", "evidence": [ { "id": "rs2059672792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2059672792" }, { "id": "rs2059672792", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2059672792" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "", "site_lbl": "N57", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "16", "chr_pos": "89635973", "evidence": [ { "id": "rs2059672792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2059672792" }, { "id": "rs2059672792", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2059672792" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "111", "site_seq": "ELYEPIWQnFTDPQLR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "ELYEPIWQnFTDPQLRR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "ELYEPIWQnFTDPQLR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "ELYEPIWQnFTDPQLRR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "ELYEPIWQnFTDPQLR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "ELYEPIWQnFTDPQLRR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "ELYEPIWQnFTDPQLR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "ELYEPIWQnFTDPQLRR", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "111", "site_seq": "N", "site_lbl": "Asn111", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12821-1", "start_pos": 111, "end_pos": 111, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1306, "chemical_mass": 149715.0 } ] }, { "start_pos": "101", "site_seq": "IAVQFGPGFSWIAnFTK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "N", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "IAVQFGPGFSWIANFTK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDnTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "N", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDNTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIKYLDFVFAVK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "IAVQFGPGFSWIAnFTK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "N", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "IAVQFGPGFSWIANFTK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDnTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "N", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDNTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIKYLDFVFAVK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "IAVQFGPGFSWIAnFTK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "N", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "IAVQFGPGFSWIANFTK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDnTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "N", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDNTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIKYLDFVFAVK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "", "site_lbl": "N123", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->YTT).", "chr_id": "X", "chr_pos": "120455387", "evidence": [ { "id": "rs1921042232", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1921042232" }, { "id": "rs1921042232", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1921042232#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "", "site_lbl": "N275", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "X", "chr_pos": "120446346", "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "X", "chr_pos": "120446346", "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "X", "chr_pos": "120446345", "evidence": [ { "id": "rs397516747", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs397516747" }, { "id": "rs397516747", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs397516747#frequency_tab" }, { "id": "rs397516747", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs397516747" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "", "site_lbl": "N356", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "X", "chr_pos": "120441756", "evidence": [ { "id": "rs775416221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775416221" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "IAVQFGPGFSWIAnFTK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "N", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "101", "site_seq": "IAVQFGPGFSWIANFTK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDnTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "N", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDNTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIKYLDFVFAVK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "", "site_lbl": "N123", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->YTT).", "chr_id": "X", "chr_pos": "120455387", "evidence": [ { "id": "rs1921042232", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1921042232" }, { "id": "rs1921042232", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1921042232#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "", "site_lbl": "N275", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "X", "chr_pos": "120446346", "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "X", "chr_pos": "120446346", "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "X", "chr_pos": "120446345", "evidence": [ { "id": "rs397516747", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs397516747" }, { "id": "rs397516747", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs397516747#frequency_tab" }, { "id": "rs397516747", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs397516747" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "", "site_lbl": "N356", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "X", "chr_pos": "120441756", "evidence": [ { "id": "rs775416221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775416221" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "", "site_lbl": "N358", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->YKS).", "chr_id": "3", "chr_pos": "149206304", "evidence": [ { "id": "rs1727717120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727717120" }, { "id": "rs1727717120", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727717120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "", "site_lbl": "N762", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "3", "chr_pos": "149183605", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" }, { "id": "rs1576737229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1576737229" }, { "id": "rs1576737229", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1576737229" } ], "disease": [ { "disease_id": "DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage.", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->TVS).", "chr_id": "3", "chr_pos": "149185239", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "", "site_lbl": "N358", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->YKS).", "chr_id": "3", "chr_pos": "149206304", "evidence": [ { "id": "rs1727717120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727717120" }, { "id": "rs1727717120", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727717120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "", "site_lbl": "N762", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "3", "chr_pos": "149183605", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" }, { "id": "rs1576737229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1576737229" }, { "id": "rs1576737229", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1576737229" } ], "disease": [ { "disease_id": "DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage.", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->TVS).", "chr_id": "3", "chr_pos": "149185239", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "144", "site_seq": "VWDTAVGLnHTAEPSLQTLER", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "N", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "VWDTAVGLNHTAEPSLQTLER", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "VWDTAVGLnHTAEPSLQTLER", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "N", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "VWDTAVGLNHTAEPSLQTLER", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "VWDTAVGLnHTAEPSLQTLER", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "N", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "VWDTAVGLNHTAEPSLQTLER", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "", "site_lbl": "N144", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->DHT).", "chr_id": "7", "chr_pos": "2647442", "evidence": [ { "id": "rs1786028361", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1786028361" }, { "id": "rs1786028361", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1786028361" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "VWDTAVGLnHTAEPSLQTLER", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "N", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "VWDTAVGLNHTAEPSLQTLER", "site_lbl": "Asn144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "144", "site_seq": "", "site_lbl": "N144", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHT->DHT).", "chr_id": "7", "chr_pos": "2647442", "evidence": [ { "id": "rs1786028361", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1786028361" }, { "id": "rs1786028361", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1786028361" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9C0H2-1", "start_pos": 144, "end_pos": 144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 523, "chemical_mass": 57545.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFnITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFNITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "N", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "VPVTLALnNTLFLIEER", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "nATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "N", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "NATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFnITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFNITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "N", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "VPVTLALnNTLFLIEER", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "nATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "N", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "NATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFnITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFNITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "N", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "VPVTLALnNTLFLIEER", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "nATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "N", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "NATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "", "site_lbl": "N234", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "15", "chr_pos": "89805376", "evidence": [ { "id": "rs1338821581", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1338821581" }, { "id": "rs1338821581", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1338821581" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "15", "chr_pos": "89805377", "evidence": [ { "id": "rs1173509041", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1173509041" }, { "id": "rs1173509041", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1173509041#frequency_tab" }, { "id": "rs1173509041", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1173509041" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "", "site_lbl": "N818", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "89792235", "evidence": [ { "id": "rs1968642413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1968642413" }, { "id": "rs1968642413", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1968642413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "N", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFnITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "AEFNITLIHPK", "site_lbl": "Asn234", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "N", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "681", "site_seq": "VPVTLALnNTLFLIEER", "site_lbl": "Asn681", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 681, "end_pos": 681, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "nATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "N", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "NATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "234", "site_seq": "", "site_lbl": "N234", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "15", "chr_pos": "89805376", "evidence": [ { "id": "rs1338821581", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1338821581" }, { "id": "rs1338821581", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1338821581" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "15", "chr_pos": "89805377", "evidence": [ { "id": "rs1173509041", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1173509041" }, { "id": "rs1173509041", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1173509041#frequency_tab" }, { "id": "rs1173509041", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1173509041" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 234, "end_pos": 234, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "", "site_lbl": "N818", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "89792235", "evidence": [ { "id": "rs1968642413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1968642413" }, { "id": "rs1968642413", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1968642413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "E", "comment": "Very low receptor activity and HCoV-229E infection.", "evidence": [ { "database": "UniProtKB", "id": "P15144", "url": "https://www.uniprot.org/uniprotkb/P15144" }, { "database": "PubMed", "id": "11559807", "url": "https://glygen.org/publication/PubMed/11559807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "", "site_lbl": "N511", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "22", "chr_pos": "24628357", "evidence": [ { "id": "rs1259125092", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1259125092" }, { "id": "rs1259125092", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1259125092" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "", "site_lbl": "N511", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "22", "chr_pos": "24628357", "evidence": [ { "id": "rs1259125092", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1259125092" }, { "id": "rs1259125092", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1259125092" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "17", "chr_pos": "66220610", "evidence": [ { "id": "rs758021466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758021466#frequency_tab" }, { "id": "rs758021466", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758021466" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "17", "chr_pos": "66220610", "evidence": [ { "id": "rs758021466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758021466#frequency_tab" }, { "id": "rs758021466", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758021466" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "VLSnNSDANLELINTWVAK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "VLSnNSDANLELINTWVAK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "VLSnNSDANLELINTWVAK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "11", "chr_pos": "57606082", "evidence": [ { "id": "rs1388269725", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388269725" }, { "id": "rs1388269725", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1388269725" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "N", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "VLSnNSDANLELINTWVAK", "site_lbl": "Asn253", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "253", "site_seq": "", "site_lbl": "N253", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "11", "chr_pos": "57606082", "evidence": [ { "id": "rs1388269725", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388269725" }, { "id": "rs1388269725", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1388269725" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05155-1", "start_pos": 253, "end_pos": 253, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 500, "chemical_mass": 55154.0 } ] }, { "start_pos": "221", "site_seq": "SIGSEPHEDHVFLVAnFSQIETLTSVFQK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "SIGSEPHEDHVFLVAnFSQIETLTSVFQK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "SIGSEPHEDHVFLVAnFSQIETLTSVFQK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "", "site_lbl": "N221", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->DFS).", "chr_id": "8", "chr_pos": "97931471", "evidence": [ { "id": "rs760010717", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760010717" }, { "id": "rs760010717", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760010717" }, { "id": "rs760010717", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760010717#frequency_tab" }, { "id": "rs760010717", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760010717" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "8", "chr_pos": "97931472", "evidence": [ { "id": "rs754832592", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754832592#frequency_tab" }, { "id": "rs754832592", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754832592" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->TFS).", "chr_id": "8", "chr_pos": "97931472", "evidence": [ { "id": "rs754832592", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754832592#frequency_tab" }, { "id": "rs754832592", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754832592" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "SIGSEPHEDHVFLVAnFSQIETLTSVFQK", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "N", "site_lbl": "Asn221", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "221", "site_seq": "", "site_lbl": "N221", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->DFS).", "chr_id": "8", "chr_pos": "97931471", "evidence": [ { "id": "rs760010717", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760010717" }, { "id": "rs760010717", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760010717" }, { "id": "rs760010717", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760010717#frequency_tab" }, { "id": "rs760010717", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760010717" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "8", "chr_pos": "97931472", "evidence": [ { "id": "rs754832592", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754832592#frequency_tab" }, { "id": "rs754832592", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754832592" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->TFS).", "chr_id": "8", "chr_pos": "97931472", "evidence": [ { "id": "rs754832592", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754832592" }, { "id": "rs754832592", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754832592#frequency_tab" }, { "id": "rs754832592", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754832592" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00339-1", "start_pos": 221, "end_pos": 221, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Matrilin-2", "gene_name": "MATN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 956, "chemical_mass": 106837.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "2", "chr_pos": "215420764", "evidence": [ { "id": "rs528350304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528350304#frequency_tab" }, { "id": "rs528350304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528350304" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "2", "chr_pos": "215420764", "evidence": [ { "id": "rs528350304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528350304#frequency_tab" }, { "id": "rs528350304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528350304" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDnTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDNTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDnTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDNTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDnTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDNTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "19", "chr_pos": "49514258", "evidence": [ { "id": "rs977467479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs977467479" }, { "id": "rs977467479", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs977467479" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->HTS).", "chr_id": "19", "chr_pos": "49514258", "evidence": [ { "id": "rs977467479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs977467479" }, { "id": "rs977467479", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs977467479" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "19", "chr_pos": "49514259", "evidence": [ { "id": "rs758794510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758794510" }, { "id": "rs758794510", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758794510" }, { "id": "rs758794510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758794510#frequency_tab" }, { "id": "rs758794510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758794510" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDnTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDNTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "19", "chr_pos": "49514258", "evidence": [ { "id": "rs977467479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs977467479" }, { "id": "rs977467479", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs977467479" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->HTS).", "chr_id": "19", "chr_pos": "49514258", "evidence": [ { "id": "rs977467479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs977467479" }, { "id": "rs977467479", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs977467479" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "19", "chr_pos": "49514259", "evidence": [ { "id": "rs758794510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758794510" }, { "id": "rs758794510", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758794510" }, { "id": "rs758794510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758794510#frequency_tab" }, { "id": "rs758794510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758794510" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVnCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVNCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "N", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVnCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVNCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "N", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVnCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVNCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "N", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVnCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVNCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "N", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "462", "site_seq": "YVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "LPDFESRYVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "N", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "YVQNGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "YVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "LPDFESRYVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "N", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "YVQNGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "YVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "LPDFESRYVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "N", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "YVQNGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "", "site_lbl": "N462", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "18", "chr_pos": "31536255", "evidence": [ { "id": "rs2144341490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2144341490" }, { "id": "rs2144341490", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2144341490" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "18", "chr_pos": "31535375", "evidence": [ { "id": "rs745484404", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745484404" }, { "id": "rs745484404", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745484404" }, { "id": "rs745484404", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745484404" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "18", "chr_pos": "31536256", "evidence": [ { "id": "rs375679311", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375679311" }, { "id": "rs375679311", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375679311" }, { "id": "rs375679311", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375679311#frequency_tab" }, { "id": "rs375679311", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375679311" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->nullGT).", "chr_id": "18", "chr_pos": "31535374", "evidence": [ { "id": "rs2510917341", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2510917341" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "YVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "LPDFESRYVQnGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "N", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "YVQNGTYTVK", "site_lbl": "Asn462", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "462", "site_seq": "", "site_lbl": "N462", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "18", "chr_pos": "31536255", "evidence": [ { "id": "rs2144341490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2144341490" }, { "id": "rs2144341490", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2144341490" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "18", "chr_pos": "31535375", "evidence": [ { "id": "rs745484404", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745484404" }, { "id": "rs745484404", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745484404" }, { "id": "rs745484404", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745484404" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "18", "chr_pos": "31536256", "evidence": [ { "id": "rs375679311", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375679311" }, { "id": "rs375679311", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375679311" }, { "id": "rs375679311", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375679311#frequency_tab" }, { "id": "rs375679311", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375679311" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] }, { "disease_id": "DOID:0110458", "name": "dilated cardiomyopathy 1BB", "description": "A dilated cardiomyopathy that has_material_basis_in mutation the DSG2 gene on chromosome 18q12.1.", "url": "http://disease-ontology.org/term/DOID:0110458", "evidence": [ { "id": "612877", "database": "MIM", "url": "https://www.omim.org/entry/612877" }, { "id": "0110458", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110458" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->nullGT).", "chr_id": "18", "chr_pos": "31535374", "evidence": [ { "id": "rs2510917341", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2510917341" } ], "disease": [ { "disease_id": "DOID:0110081", "name": "arrhythmogenic right ventricular dysplasia 10", "description": "An arrhythmogenic right ventricular dysplasia that has_material_basis_in heterozygous mutation in the desmoglein-2 gene (DSG2) on chromosome 18q12.", "url": "http://disease-ontology.org/term/DOID:0110081", "evidence": [ { "id": "610193", "database": "MIM", "url": "https://www.omim.org/entry/610193" }, { "id": "0110081", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110081" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14126-1", "start_pos": 462, "end_pos": 462, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Desmoglein-2", "gene_name": "DSG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1118, "chemical_mass": 122294.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "", "site_lbl": "N546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "X", "chr_pos": "15572229", "evidence": [ { "id": "rs761944150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761944150#frequency_tab" }, { "id": "rs761944150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761944150" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "X", "chr_pos": "15572228", "evidence": [ { "id": "rs756905974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs756905974" }, { "id": "rs756905974", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756905974" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "", "site_lbl": "N546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "X", "chr_pos": "15572229", "evidence": [ { "id": "rs761944150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761944150#frequency_tab" }, { "id": "rs761944150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761944150" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "X", "chr_pos": "15572228", "evidence": [ { "id": "rs756905974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs756905974" }, { "id": "rs756905974", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756905974" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "1810", "site_seq": "nMTALEK", "site_lbl": "Asn1810", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1810, "end_pos": 1810, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1810", "site_seq": "N", "site_lbl": "Asn1810", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1810, "end_pos": 1810, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1810", "site_seq": "nMTALEK", "site_lbl": "Asn1810", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1810, "end_pos": 1810, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1810", "site_seq": "N", "site_lbl": "Asn1810", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1810, "end_pos": 1810, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1810", "site_seq": "nMTALEK", "site_lbl": "Asn1810", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1810, "end_pos": 1810, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1810", "site_seq": "N", "site_lbl": "Asn1810", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1810, "end_pos": 1810, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1810", "site_seq": "", "site_lbl": "N1810", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->KMT).", "chr_id": "6", "chr_pos": "129393240", "evidence": [ { "id": "rs1005888452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1005888452" }, { "id": "rs1005888452", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1005888452#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NMT->SMT).", "chr_id": "6", "chr_pos": "129393239", "evidence": [ { "id": "P24043", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P24043" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->nullMT).", "chr_id": "6", "chr_pos": "129393239", "evidence": [ { "id": "rs1211886873", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1211886873" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1810, "end_pos": 1810, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1810", "site_seq": "nMTALEK", "site_lbl": "Asn1810", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1810, "end_pos": 1810, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1810", "site_seq": "N", "site_lbl": "Asn1810", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1810, "end_pos": 1810, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1810", "site_seq": "", "site_lbl": "N1810", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->KMT).", "chr_id": "6", "chr_pos": "129393240", "evidence": [ { "id": "rs1005888452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1005888452" }, { "id": "rs1005888452", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1005888452#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NMT->SMT).", "chr_id": "6", "chr_pos": "129393239", "evidence": [ { "id": "P24043", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P24043" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->nullMT).", "chr_id": "6", "chr_pos": "129393239", "evidence": [ { "id": "rs1211886873", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1211886873" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1810, "end_pos": 1810, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "295", "site_seq": "EIVCnVTLGGER", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "EIVCnVTLGGERR", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "N", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "EIVCnVTLGGER", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "EIVCnVTLGGERR", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "N", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "EIVCnVTLGGER", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "EIVCnVTLGGERR", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "N", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "EIVCnVTLGGER", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "EIVCnVTLGGERR", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "295", "site_seq": "N", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32942-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 3", "gene_name": "ICAM3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 547, "chemical_mass": 59541.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "", "site_lbl": "N43", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "11", "chr_pos": "33717411", "evidence": [ { "id": "rs1351382260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351382260" }, { "id": "rs1351382260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351382260#frequency_tab" }, { "id": "rs1351382260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351382260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "", "site_lbl": "N43", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "11", "chr_pos": "33717411", "evidence": [ { "id": "rs1351382260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351382260" }, { "id": "rs1351382260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351382260#frequency_tab" }, { "id": "rs1351382260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351382260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "240", "site_seq": "LTLQPVDnSTISLQMGTNK", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "LTLQPVDNSTISLQMGTNK", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "LTLQPVDnSTISLQMGTNK", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "LTLQPVDNSTISLQMGTNK", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "LTLQPVDnSTISLQMGTNK", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "LTLQPVDNSTISLQMGTNK", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "", "site_lbl": "N240", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "1", "chr_pos": "94898013", "evidence": [ { "id": "rs774452812", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774452812" }, { "id": "rs774452812", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774452812" }, { "id": "rs774452812", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774452812#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "LTLQPVDnSTISLQMGTNK", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "LTLQPVDNSTISLQMGTNK", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "240", "site_seq": "", "site_lbl": "N240", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "1", "chr_pos": "94898013", "evidence": [ { "id": "rs774452812", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774452812" }, { "id": "rs774452812", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774452812" }, { "id": "rs774452812", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774452812#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15417-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calponin-3", "gene_name": "CNN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 329, "chemical_mass": 36414.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "N354", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "8", "chr_pos": "27599882", "evidence": [ { "id": "rs1800687134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1800687134" }, { "id": "rs1800687134", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1800687134" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "N354", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "8", "chr_pos": "27599882", "evidence": [ { "id": "rs1800687134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1800687134" }, { "id": "rs1800687134", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1800687134" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-374. Decreases secretion; when associated with Q-291 and Q-374.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "", "site_lbl": "N469", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "1", "chr_pos": "206934719", "evidence": [ { "id": "rs767674762", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767674762#frequency_tab" }, { "id": "rs767674762", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767674762" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "", "site_lbl": "N469", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "1", "chr_pos": "206934719", "evidence": [ { "id": "rs767674762", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767674762#frequency_tab" }, { "id": "rs767674762", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767674762" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnKTEDTIFLR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "QDQCIYnTTYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnKTEDTIFLR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "QDQCIYnTTYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnKTEDTIFLR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "QDQCIYnTTYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "", "site_lbl": "N72", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->HKT).", "chr_id": "9", "chr_pos": "114323762", "evidence": [ { "id": "rs1829722391", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1829722391" }, { "id": "rs1829722391", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1829722391" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "9", "chr_pos": "114323764", "evidence": [ { "id": "rs1588922174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1588922174" }, { "id": "rs1588922174", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1588922174" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "9", "chr_pos": "114323763", "evidence": [ { "id": "rs746201043", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746201043#frequency_tab" }, { "id": "rs746201043", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746201043" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "", "site_lbl": "N93", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "9", "chr_pos": "114324038", "evidence": [ { "id": "rs775455856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775455856#frequency_tab" }, { "id": "rs775455856", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775455856" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "9", "chr_pos": "114324038", "evidence": [ { "id": "rs775455856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775455856#frequency_tab" }, { "id": "rs775455856", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775455856" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "N", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnK", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "SVQEIQATFFYFTPnKTEDTIFLR", "site_lbl": "Asn72", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "QDQCIYnTTYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "72", "site_seq": "", "site_lbl": "N72", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->HKT).", "chr_id": "9", "chr_pos": "114323762", "evidence": [ { "id": "rs1829722391", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1829722391" }, { "id": "rs1829722391", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1829722391" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "9", "chr_pos": "114323764", "evidence": [ { "id": "rs1588922174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1588922174" }, { "id": "rs1588922174", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1588922174" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "9", "chr_pos": "114323763", "evidence": [ { "id": "rs746201043", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746201043#frequency_tab" }, { "id": "rs746201043", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746201043" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 72, "end_pos": 72, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "93", "site_seq": "", "site_lbl": "N93", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "9", "chr_pos": "114324038", "evidence": [ { "id": "rs775455856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775455856#frequency_tab" }, { "id": "rs775455856", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775455856" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "9", "chr_pos": "114324038", "evidence": [ { "id": "rs775455856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775455856#frequency_tab" }, { "id": "rs775455856", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775455856" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02763-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23540.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "184", "site_seq": "GPnCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "GPNCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "GPnCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "GPNCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "GPnCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "GPNCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "9", "chr_pos": "115087180", "evidence": [ { "id": "rs778574555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778574555" }, { "id": "rs778574555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778574555" }, { "id": "rs778574555", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778574555#frequency_tab" }, { "id": "rs778574555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778574555" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "GPnCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "GPNCSEPECPGNCHLR", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "9", "chr_pos": "115087180", "evidence": [ { "id": "rs778574555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778574555" }, { "id": "rs778574555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778574555" }, { "id": "rs778574555", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778574555#frequency_tab" }, { "id": "rs778574555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778574555" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1581", "site_seq": "N", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "AWGTPCEMCPAVnTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "ASCCCSLGKAWGTPCEMCPAVNTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "N", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "AWGTPCEMCPAVnTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "ASCCCSLGKAWGTPCEMCPAVNTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "N", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "AWGTPCEMCPAVnTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "ASCCCSLGKAWGTPCEMCPAVNTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "", "site_lbl": "N1581", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "15", "chr_pos": "48467943", "evidence": [ { "id": "rs2505501431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2505501431" } ], "disease": [ { "disease_id": "DOID:14323", "name": "Marfan syndrome", "description": "A connective tissue disease that is characterized by tall stature, elongated extremities, mitral valve prolapse, aortic dilatation, aortic dissection, and subluxation of the lens.", "url": "http://disease-ontology.org/term/DOID:14323", "evidence": [ { "id": "14323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14323" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "N", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "AWGTPCEMCPAVnTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "ASCCCSLGKAWGTPCEMCPAVNTSEYK", "site_lbl": "Asn1581", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1581", "site_seq": "", "site_lbl": "N1581", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "15", "chr_pos": "48467943", "evidence": [ { "id": "rs2505501431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2505501431" } ], "disease": [ { "disease_id": "DOID:14323", "name": "Marfan syndrome", "description": "A connective tissue disease that is characterized by tall stature, elongated extremities, mitral valve prolapse, aortic dilatation, aortic dissection, and subluxation of the lens.", "url": "http://disease-ontology.org/term/DOID:14323", "evidence": [ { "id": "14323", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14323" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1581, "end_pos": 1581, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVnFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVNFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVnFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVNFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVnFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVNFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "", "site_lbl": "N3780", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "21831665", "evidence": [ { "id": "rs763508790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763508790#frequency_tab" }, { "id": "rs763508790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763508790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "", "site_lbl": "N89", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "1", "chr_pos": "21890673", "evidence": [ { "id": "rs1175912363", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1175912363" }, { "id": "rs1175912363", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1175912363" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "1", "chr_pos": "21890673", "evidence": [ { "id": "P98160", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98160" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVnFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "N", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "ALVNFTR", "site_lbl": "Asn89", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "", "site_lbl": "N3780", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "21831665", "evidence": [ { "id": "rs763508790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763508790#frequency_tab" }, { "id": "rs763508790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763508790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "89", "site_seq": "", "site_lbl": "N89", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "1", "chr_pos": "21890673", "evidence": [ { "id": "rs1175912363", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1175912363" }, { "id": "rs1175912363", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1175912363" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "1", "chr_pos": "21890673", "evidence": [ { "id": "P98160", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98160" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 89, "end_pos": 89, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTnSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTNSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTnSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTNSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTnSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTNSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "", "site_lbl": "N551", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "17", "chr_pos": "78971682", "evidence": [ { "id": "rs773114062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773114062" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTnSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "AAIPSALDTNSSK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "551", "site_seq": "", "site_lbl": "N551", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "17", "chr_pos": "78971682", "evidence": [ { "id": "rs773114062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773114062" }, { "id": "rs773114062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773114062" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "922", "site_seq": "TTSTLSLSAEDSQSTESnMSVPK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BQF6-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sentrin-specific protease 7", "gene_name": "SENP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1050, "chemical_mass": 119658.0 } ] }, { "start_pos": "922", "site_seq": "TTSTLSLSAEDSQSTESnMSVPK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BQF6-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sentrin-specific protease 7", "gene_name": "SENP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1050, "chemical_mass": 119658.0 } ] }, { "start_pos": "922", "site_seq": "TTSTLSLSAEDSQSTESnMSVPK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BQF6-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sentrin-specific protease 7", "gene_name": "SENP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1050, "chemical_mass": 119658.0 } ] }, { "start_pos": "922", "site_seq": "TTSTLSLSAEDSQSTESnMSVPK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BQF6-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sentrin-specific protease 7", "gene_name": "SENP7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1050, "chemical_mass": 119658.0 } ] }, { "start_pos": "167", "site_seq": "nQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "NQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "nQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "NQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "nQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "NQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "15", "chr_pos": "77052862", "evidence": [ { "id": "rs2076741164", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2076741164" }, { "id": "rs2076741164", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2076741164" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "nQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "N", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "NQSVPLSCCR", "site_lbl": "Asn167", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "167", "site_seq": "", "site_lbl": "N167", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "15", "chr_pos": "77052862", "evidence": [ { "id": "rs2076741164", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2076741164" }, { "id": "rs2076741164", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2076741164" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60637-1", "start_pos": 167, "end_pos": 167, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-3", "gene_name": "TSPAN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 253, "chemical_mass": 28018.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "YELRVDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFENNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "YELRVDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFENNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "YELRVDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFENNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "YELRVDLEDFEnNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "N", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "137", "site_seq": "VDLEDFENNTAYAK", "site_lbl": "Asn137", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55083-1", "start_pos": 137, "end_pos": 137, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Microfibril-associated glycoprotein 4", "gene_name": "MFAP4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 28648.0 } ] }, { "start_pos": "416", "site_seq": "IDSTGnVTNELR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "N", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "IDSTGNVTNELR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "IDSTGnVTNELR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "N", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "IDSTGNVTNELR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "IDSTGnVTNELR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "N", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "IDSTGNVTNELR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "IDSTGnVTNELR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "N", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "416", "site_seq": "IDSTGNVTNELR", "site_lbl": "Asn416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O75882-1", "start_pos": 416, "end_pos": 416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Attractin", "gene_name": "ATRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1429, "chemical_mass": 158537.0 } ] }, { "start_pos": "145", "site_seq": "SCInESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "SCINESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDRNDPMLLYNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIANATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "SCInESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "SCINESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDRNDPMLLYNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIANATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "SCInESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "SCINESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDRNDPMLLYNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIANATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NES->HES).", "chr_id": "3", "chr_pos": "155116553", "evidence": [ { "id": "P08473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08473" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "3", "chr_pos": "155138234", "evidence": [ { "id": "rs1339178202", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1339178202" }, { "id": "rs1339178202", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1339178202" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "3", "chr_pos": "155138235", "evidence": [ { "id": "rs200961860", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200961860" }, { "id": "rs200961860", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200961860#frequency_tab" }, { "id": "rs200961860", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200961860" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "3", "chr_pos": "155138236", "evidence": [ { "id": "P08473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08473" }, { "id": "rs1434664230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1434664230" }, { "id": "rs1434664230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1434664230" }, { "id": "rs1434664230", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1434664230" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "3", "chr_pos": "155138235", "evidence": [ { "id": "rs200961860", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200961860" }, { "id": "rs200961860", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200961860#frequency_tab" }, { "id": "rs200961860", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200961860" } ], "disease": [ { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "SCInESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "SCINESAIDSR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDRNDPMLLYNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIANATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NES->HES).", "chr_id": "3", "chr_pos": "155116553", "evidence": [ { "id": "P08473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08473" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "3", "chr_pos": "155138234", "evidence": [ { "id": "rs1339178202", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1339178202" }, { "id": "rs1339178202", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1339178202" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "3", "chr_pos": "155138235", "evidence": [ { "id": "rs200961860", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200961860" }, { "id": "rs200961860", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200961860#frequency_tab" }, { "id": "rs200961860", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200961860" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "3", "chr_pos": "155138236", "evidence": [ { "id": "P08473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08473" }, { "id": "rs1434664230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1434664230" }, { "id": "rs1434664230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1434664230" }, { "id": "rs1434664230", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1434664230" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "3", "chr_pos": "155138235", "evidence": [ { "id": "rs200961860", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200961860" }, { "id": "rs200961860", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200961860#frequency_tab" }, { "id": "rs200961860", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200961860" } ], "disease": [ { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "128", "site_seq": "MDnISR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "ELLLDFAnSSAELTGCLVR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "ELLLDFANSSAELTGCLVR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "128", "site_seq": "MDnISR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "ELLLDFAnSSAELTGCLVR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "ELLLDFANSSAELTGCLVR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "128", "site_seq": "MDnISR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "ELLLDFAnSSAELTGCLVR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "ELLLDFANSSAELTGCLVR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "6", "chr_pos": "108074268", "evidence": [ { "id": "rs1181939981", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1181939981" }, { "id": "rs1181939981", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1181939981#frequency_tab" }, { "id": "rs1181939981", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1181939981" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "", "site_lbl": "N93", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "6", "chr_pos": "108074375", "evidence": [ { "id": "rs1204561499", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1204561499" }, { "id": "rs1204561499", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1204561499#frequency_tab" }, { "id": "rs1204561499", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1204561499" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "6", "chr_pos": "108074374", "evidence": [ { "id": "rs1354770509", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1354770509" }, { "id": "rs1354770509", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1354770509#frequency_tab" }, { "id": "rs1354770509", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1354770509" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "128", "site_seq": "MDnISR", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "ELLLDFAnSSAELTGCLVR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "ELLLDFANSSAELTGCLVR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "6", "chr_pos": "108074268", "evidence": [ { "id": "rs1181939981", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1181939981" }, { "id": "rs1181939981", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1181939981#frequency_tab" }, { "id": "rs1181939981", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1181939981" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "93", "site_seq": "", "site_lbl": "N93", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "6", "chr_pos": "108074375", "evidence": [ { "id": "rs1204561499", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1204561499" }, { "id": "rs1204561499", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1204561499#frequency_tab" }, { "id": "rs1204561499", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1204561499" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "6", "chr_pos": "108074374", "evidence": [ { "id": "rs1354770509", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1354770509" }, { "id": "rs1354770509", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1354770509#frequency_tab" }, { "id": "rs1354770509", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1354770509" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86WC4-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 334, "chemical_mass": 37257.0 } ] }, { "start_pos": "281", "site_seq": "ELYLQNNYLTDEGLDnETFWK", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "N", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "ELYLQNNYLTDEGLDnETFWK", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "N", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "ELYLQNNYLTDEGLDnETFWK", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "N", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "", "site_lbl": "N281", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->HET).", "chr_id": "1", "chr_pos": "53077787", "evidence": [ { "id": "rs1364224974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1364224974" }, { "id": "rs1364224974", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1364224974#frequency_tab" }, { "id": "rs1364224974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1364224974" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "1", "chr_pos": "53077789", "evidence": [ { "id": "rs567995586", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs567995586" }, { "id": "rs567995586", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs567995586" }, { "id": "rs567995586", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs567995586" }, { "id": "rs567995586", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs567995586#frequency_tab" }, { "id": "rs567995586", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs567995586" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "ELYLQNNYLTDEGLDnETFWK", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "N", "site_lbl": "Asn281", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "281", "site_seq": "", "site_lbl": "N281", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->HET).", "chr_id": "1", "chr_pos": "53077787", "evidence": [ { "id": "rs1364224974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1364224974" }, { "id": "rs1364224974", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1364224974#frequency_tab" }, { "id": "rs1364224974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1364224974" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "1", "chr_pos": "53077789", "evidence": [ { "id": "rs567995586", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs567995586" }, { "id": "rs567995586", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs567995586" }, { "id": "rs567995586", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs567995586" }, { "id": "rs567995586", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs567995586#frequency_tab" }, { "id": "rs567995586", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs567995586" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z5L7-1", "start_pos": 281, "end_pos": 281, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocan", "gene_name": "PODN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 613, "chemical_mass": 68976.0 } ] }, { "start_pos": "1323", "site_seq": "VILILDPAISGnETQPYPAFTR", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "N", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "VILILDPAISGnETQPYPAFTR", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "N", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "VILILDPAISGnETQPYPAFTR", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "N", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "VILILDPAISGnETQPYPAFTR", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "N", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "LRNPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQNCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGRK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVNGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "CHEGnGTFECGACR", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "N", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "CHEGNGTFECGACR", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "LRNPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQNCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGRK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVNGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "CHEGnGTFECGACR", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "N", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "CHEGNGTFECGACR", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "LRNPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQNCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGRK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVNGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "CHEGnGTFECGACR", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "N", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "CHEGNGTFECGACR", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "", "site_lbl": "N406", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "10", "chr_pos": "32920306", "evidence": [ { "id": "rs2094945297", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2094945297" }, { "id": "rs2094945297", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2094945297#frequency_tab" }, { "id": "rs2094945297", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2094945297" }, { "id": "rs2505884571", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2505884571" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "LRNPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQNCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGRK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVNGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "CHEGnGTFECGACR", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "N", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "481", "site_seq": "CHEGNGTFECGACR", "site_lbl": "Asn481", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 481, "end_pos": 481, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "", "site_lbl": "N406", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "10", "chr_pos": "32920306", "evidence": [ { "id": "rs2094945297", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2094945297" }, { "id": "rs2094945297", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2094945297#frequency_tab" }, { "id": "rs2094945297", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2094945297" }, { "id": "rs2505884571", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2505884571" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGnDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGNDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGnDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGNDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGnDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGNDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "", "site_lbl": "N267", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "19", "chr_pos": "10284195", "evidence": [ { "id": "rs755625816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755625816" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGnDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGNDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "", "site_lbl": "N267", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "19", "chr_pos": "10284195", "evidence": [ { "id": "rs755625816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755625816" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLAnDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "N", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLANDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVnTTHRPFDIHVYHPYR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVNTTHR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "N", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLAnDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "N", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLANDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVnTTHRPFDIHVYHPYR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVNTTHR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "N", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLAnDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "N", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLANDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVnTTHRPFDIHVYHPYR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVNTTHR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "N", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "", "site_lbl": "N1383", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "2", "chr_pos": "169239674", "evidence": [ { "id": "rs1689734706", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1689734706" }, { "id": "rs1689734706", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1689734706#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "2", "chr_pos": "169239673", "evidence": [ { "id": "rs747142179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747142179" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "2", "chr_pos": "169239673", "evidence": [ { "id": "rs747142179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747142179" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "", "site_lbl": "N2809", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->HNT).", "chr_id": "2", "chr_pos": "169201655", "evidence": [ { "id": "rs768363457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768363457" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169201654", "evidence": [ { "id": "rs191087468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191087468" }, { "id": "rs191087468", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191087468" }, { "id": "rs191087468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs191087468#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "", "site_lbl": "N3446", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "2", "chr_pos": "169177858", "evidence": [ { "id": "rs1257823353", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257823353" }, { "id": "rs1257823353", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257823353#frequency_tab" }, { "id": "rs1257823353", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257823353" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLAnDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "N", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLANDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVnTTHRPFDIHVYHPYR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVNTTHR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "N", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "", "site_lbl": "N1383", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "2", "chr_pos": "169239674", "evidence": [ { "id": "rs1689734706", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1689734706" }, { "id": "rs1689734706", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1689734706#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "2", "chr_pos": "169239673", "evidence": [ { "id": "rs747142179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747142179" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "2", "chr_pos": "169239673", "evidence": [ { "id": "rs747142179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747142179" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "", "site_lbl": "N2809", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->HNT).", "chr_id": "2", "chr_pos": "169201655", "evidence": [ { "id": "rs768363457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768363457" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169201654", "evidence": [ { "id": "rs191087468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191087468" }, { "id": "rs191087468", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191087468" }, { "id": "rs191087468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs191087468#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "", "site_lbl": "N3446", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "2", "chr_pos": "169177858", "evidence": [ { "id": "rs1257823353", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257823353" }, { "id": "rs1257823353", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257823353#frequency_tab" }, { "id": "rs1257823353", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257823353" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "348", "site_seq": "TSQEnISFETMYDVLSTKPVLNK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "TSQEnISFETMYDVLSTKPVLNK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "TSQEnISFETMYDVLSTKPVLNK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "8", "chr_pos": "18058891", "evidence": [ { "id": "rs1799575422", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799575422" }, { "id": "rs1799575422", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799575422" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "8", "chr_pos": "18058890", "evidence": [ { "id": "rs781477468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781477468" }, { "id": "rs781477468", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781477468" }, { "id": "rs781477468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781477468#frequency_tab" }, { "id": "rs781477468", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781477468" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->nullIS).", "chr_id": "8", "chr_pos": "18058888_18058891", "evidence": [ { "id": "rs2537913430", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2537913430" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "TSQEnISFETMYDVLSTKPVLNK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "8", "chr_pos": "18058891", "evidence": [ { "id": "rs1799575422", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799575422" }, { "id": "rs1799575422", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799575422" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "8", "chr_pos": "18058890", "evidence": [ { "id": "rs781477468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781477468" }, { "id": "rs781477468", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781477468" }, { "id": "rs781477468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781477468#frequency_tab" }, { "id": "rs781477468", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781477468" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->nullIS).", "chr_id": "8", "chr_pos": "18058888_18058891", "evidence": [ { "id": "rs2537913430", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2537913430" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on ceramide catabolic process.", "evidence": [ { "database": "UniProtKB", "id": "Q13510", "url": "https://www.uniprot.org/uniprotkb/Q13510" }, { "database": "PubMed", "id": "11451951", "url": "https://glygen.org/publication/PubMed/11451951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "3", "chr_pos": "52782190", "evidence": [ { "id": "rs1370350537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1370350537" }, { "id": "rs1370350537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1370350537" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "3", "chr_pos": "52782191", "evidence": [ { "id": "rs2154108330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2154108330" }, { "id": "rs2154108330", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2154108330" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "3", "chr_pos": "52782190", "evidence": [ { "id": "rs1370350537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1370350537" }, { "id": "rs1370350537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1370350537" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "3", "chr_pos": "52782191", "evidence": [ { "id": "rs2154108330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2154108330" }, { "id": "rs2154108330", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2154108330" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "1816", "site_seq": "MDGCTLTDEQLLYSFnLSSLSTSTFK", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "MDGCTLTDEQLLYSFNLSSLSTSTFK", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "N", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVnGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVNGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "MDGCTLTDEQLLYSFnLSSLSTSTFK", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "MDGCTLTDEQLLYSFNLSSLSTSTFK", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "N", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVnGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVNGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "MDGCTLTDEQLLYSFnLSSLSTSTFK", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "MDGCTLTDEQLLYSFNLSSLSTSTFK", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "N", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVnGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVNGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "", "site_lbl": "N1816", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "6", "chr_pos": "160078330", "evidence": [ { "id": "rs747144122", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747144122" }, { "id": "rs747144122", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747144122" }, { "id": "rs747144122", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747144122" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "6", "chr_pos": "160078331", "evidence": [ { "id": "rs1778899449", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1778899449" }, { "id": "rs1778899449", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1778899449" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "", "site_lbl": "N871", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "6", "chr_pos": "160050569", "evidence": [ { "id": "rs1778172796", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1778172796" }, { "id": "rs1778172796", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1778172796#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "MDGCTLTDEQLLYSFnLSSLSTSTFK", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "MDGCTLTDEQLLYSFNLSSLSTSTFK", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "N", "site_lbl": "Asn1816", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVnGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVNGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "1816", "site_seq": "", "site_lbl": "N1816", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "6", "chr_pos": "160078330", "evidence": [ { "id": "rs747144122", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747144122" }, { "id": "rs747144122", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747144122" }, { "id": "rs747144122", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747144122" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "6", "chr_pos": "160078331", "evidence": [ { "id": "rs1778899449", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1778899449" }, { "id": "rs1778899449", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1778899449" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 1816, "end_pos": 1816, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "", "site_lbl": "N871", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "6", "chr_pos": "160050569", "evidence": [ { "id": "rs1778172796", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1778172796" }, { "id": "rs1778172796", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1778172796#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "332", "site_seq": "HLRDEIQVnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "DEIQVnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "HLRDEIQVnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "DEIQVnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "HLRDEIQVnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "DEIQVnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "HLRDEIQVnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "DEIQVnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07837-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A1", "gene_name": "SLC3A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 685, "chemical_mass": 78852.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTnSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTNSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTnSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTNSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTnSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTNSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "", "site_lbl": "N381", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "11", "chr_pos": "62885196", "evidence": [ { "id": "rs751788730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751788730" }, { "id": "rs751788730", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751788730" }, { "id": "rs751788730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751788730" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTnSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTNSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "", "site_lbl": "N381", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "11", "chr_pos": "62885196", "evidence": [ { "id": "rs751788730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751788730" }, { "id": "rs751788730", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751788730" }, { "id": "rs751788730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751788730" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Impairs both the stability and the trafficking of SLC3A2 to the plasma membrane; when associated with Q-365; Q-424 and Q-506.", "evidence": [ { "database": "UniProtKB", "id": "P08195", "url": "https://www.uniprot.org/uniprotkb/P08195" }, { "database": "PubMed", "id": "36028562", "url": "https://glygen.org/publication/PubMed/36028562" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "365", "site_seq": "QHDYIIEFFDYTTVLKPSLnFTATVK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "PSLNFTATVK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "N", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "QHDYIIEFFDYTTVLKPSLnFTATVK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "PSLNFTATVK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "N", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "QHDYIIEFFDYTTVLKPSLnFTATVK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "PSLNFTATVK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "N", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "", "site_lbl": "N365", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->HFT).", "chr_id": "6", "chr_pos": "73763671", "evidence": [ { "id": "rs749700855", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749700855" }, { "id": "rs749700855", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749700855" }, { "id": "rs749700855", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749700855" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "6", "chr_pos": "73763672", "evidence": [ { "id": "rs1582121049", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1582121049" }, { "id": "rs1582121049", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1582121049" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "QHDYIIEFFDYTTVLKPSLnFTATVK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "PSLNFTATVK", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "N", "site_lbl": "Asn365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "365", "site_seq": "", "site_lbl": "N365", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->HFT).", "chr_id": "6", "chr_pos": "73763671", "evidence": [ { "id": "rs749700855", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749700855" }, { "id": "rs749700855", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749700855" }, { "id": "rs749700855", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749700855" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "6", "chr_pos": "73763672", "evidence": [ { "id": "rs1582121049", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1582121049" }, { "id": "rs1582121049", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1582121049" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 365, "end_pos": 365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "93", "site_seq": "QNQCFYnSSYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19652-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23603.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19652-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23603.0 } ] }, { "start_pos": "93", "site_seq": "QNQCFYnSSYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19652-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23603.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19652-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23603.0 } ] }, { "start_pos": "93", "site_seq": "QNQCFYnSSYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19652-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23603.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19652-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23603.0 } ] }, { "start_pos": "93", "site_seq": "QNQCFYnSSYLNVQR", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19652-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23603.0 } ] }, { "start_pos": "93", "site_seq": "N", "site_lbl": "Asn93", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19652-1", "start_pos": 93, "end_pos": 93, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 201, "chemical_mass": 23603.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "1", "chr_pos": "203486711", "evidence": [ { "id": "rs958031131", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs958031131" }, { "id": "rs958031131", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs958031131#frequency_tab" }, { "id": "rs958031131", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs958031131" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "203486712", "evidence": [ { "id": "rs760584616", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760584616" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "1", "chr_pos": "203486711", "evidence": [ { "id": "rs958031131", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs958031131" }, { "id": "rs958031131", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs958031131#frequency_tab" }, { "id": "rs958031131", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs958031131" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "203486712", "evidence": [ { "id": "rs760584616", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760584616" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "1348", "site_seq": "RAnTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "AnTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "ANTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "N", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "RAnTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "AnTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "ANTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "N", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "RAnTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "AnTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "ANTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "N", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "", "site_lbl": "N1348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "3", "chr_pos": "49123314", "evidence": [ { "id": "rs1459957730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459957730" }, { "id": "rs1459957730", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1459957730#frequency_tab" }, { "id": "rs1459957730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1459957730" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->HTS).", "chr_id": "3", "chr_pos": "49123314", "evidence": [ { "id": "rs1459957730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459957730" }, { "id": "rs1459957730", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1459957730#frequency_tab" }, { "id": "rs1459957730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1459957730" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->ITS).", "chr_id": "3", "chr_pos": "49123313", "evidence": [ { "id": "rs771215576", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771215576#frequency_tab" }, { "id": "rs771215576", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771215576" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "3", "chr_pos": "49123313", "evidence": [ { "id": "rs771215576", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771215576#frequency_tab" }, { "id": "rs771215576", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771215576" } ], "disease": [ { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "RAnTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "AnTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "ANTSALAVPSPVSNSASAR", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "N", "site_lbl": "Asn1348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "1348", "site_seq": "", "site_lbl": "N1348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "3", "chr_pos": "49123314", "evidence": [ { "id": "rs1459957730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459957730" }, { "id": "rs1459957730", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1459957730#frequency_tab" }, { "id": "rs1459957730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1459957730" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->HTS).", "chr_id": "3", "chr_pos": "49123314", "evidence": [ { "id": "rs1459957730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459957730" }, { "id": "rs1459957730", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1459957730#frequency_tab" }, { "id": "rs1459957730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1459957730" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->ITS).", "chr_id": "3", "chr_pos": "49123313", "evidence": [ { "id": "rs771215576", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771215576#frequency_tab" }, { "id": "rs771215576", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771215576" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "3", "chr_pos": "49123313", "evidence": [ { "id": "rs771215576", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771215576" }, { "id": "rs771215576", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771215576#frequency_tab" }, { "id": "rs771215576", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771215576" } ], "disease": [ { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0080380", "name": "nephrotic syndrome type 5", "description": "A familial nephrotic syndrome characterized by prenatal or neonatal onset of progressive renal failure with proteinurea and edema that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p.", "url": "http://disease-ontology.org/term/DOID:0080380", "evidence": [ { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" }, { "id": "0080380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080380" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] }, { "disease_id": "DOID:0060852", "name": "Pierson syndrome", "description": "A syndrome characterized by nephrotic syndrome with diffuse mesangial sclerosis, proteinuria, microcoria, absence of the pupillary dilator muscle in the iris, ciliary muscle atrophy, and abnormal eye development with lens-shape, retinal and corneal anomalies that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB2 gene on chromosome 3p21.", "url": "http://disease-ontology.org/term/DOID:0060852", "evidence": [ { "id": "0060852", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060852" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55268-1", "start_pos": 1348, "end_pos": 1348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-2", "gene_name": "LAMB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1798, "chemical_mass": 195981.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "186617300", "evidence": [ { "id": "rs1244707129", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244707129" }, { "id": "rs1244707129", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244707129" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "3", "chr_pos": "186617302", "evidence": [ { "id": "rs770113523", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770113523" }, { "id": "rs770113523", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770113523" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "186617301", "evidence": [ { "id": "rs556158119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556158119" }, { "id": "rs556158119", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs556158119#frequency_tab" }, { "id": "rs556158119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556158119" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "3", "chr_pos": "186617303", "evidence": [ { "id": "rs1167553984", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167553984" }, { "id": "rs1167553984", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1167553984" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "186617300", "evidence": [ { "id": "rs1244707129", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244707129" }, { "id": "rs1244707129", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244707129" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "3", "chr_pos": "186617302", "evidence": [ { "id": "rs770113523", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770113523" }, { "id": "rs770113523", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770113523" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "186617301", "evidence": [ { "id": "rs556158119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556158119" }, { "id": "rs556158119", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs556158119#frequency_tab" }, { "id": "rs556158119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556158119" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "3", "chr_pos": "186617303", "evidence": [ { "id": "rs1167553984", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167553984" }, { "id": "rs1167553984", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1167553984" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALRWLGR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "ERSWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALRWLGR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "ERSWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALRWLGR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "ERSWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "11", "chr_pos": "6437582", "evidence": [ { "id": "rs1590805267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1590805267" }, { "id": "rs1590805267", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1590805267" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "SWPAVGnCSSALRWLGR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "ERSWPAVGnCSSALR", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "11", "chr_pos": "6437582", "evidence": [ { "id": "rs1590805267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1590805267" }, { "id": "rs1590805267", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1590805267" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "286", "site_seq": "AEAVGETLTLPGLVSADnGTYTCEASNK", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFZ8-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell adhesion molecule 4", "gene_name": "CADM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 42785.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFZ8-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell adhesion molecule 4", "gene_name": "CADM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 42785.0 } ] }, { "start_pos": "286", "site_seq": "AEAVGETLTLPGLVSADnGTYTCEASNK", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFZ8-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell adhesion molecule 4", "gene_name": "CADM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 42785.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFZ8-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell adhesion molecule 4", "gene_name": "CADM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 42785.0 } ] }, { "start_pos": "286", "site_seq": "AEAVGETLTLPGLVSADnGTYTCEASNK", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFZ8-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell adhesion molecule 4", "gene_name": "CADM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 42785.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFZ8-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell adhesion molecule 4", "gene_name": "CADM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 42785.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "19", "chr_pos": "43625149", "evidence": [ { "id": "rs773454234", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773454234" }, { "id": "rs773454234", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773454234" }, { "id": "rs773454234", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773454234" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFZ8-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell adhesion molecule 4", "gene_name": "CADM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 42785.0 } ] }, { "start_pos": "286", "site_seq": "AEAVGETLTLPGLVSADnGTYTCEASNK", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFZ8-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell adhesion molecule 4", "gene_name": "CADM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 42785.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFZ8-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell adhesion molecule 4", "gene_name": "CADM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 42785.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "19", "chr_pos": "43625149", "evidence": [ { "id": "rs773454234", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773454234" }, { "id": "rs773454234", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773454234" }, { "id": "rs773454234", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773454234" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NFZ8-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cell adhesion molecule 4", "gene_name": "CADM4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 42785.0 } ] }, { "start_pos": "249", "site_seq": "FIASFNVVnTTK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "FIASFNVVNTTK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "FIASFNVVnTTK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "FIASFNVVNTTK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "FIASFNVVnTTK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "FIASFNVVNTTK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->ITT).", "chr_id": "NC_000018.10", "chr_pos": "7949263", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "FIASFNVVnTTK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "FIASFNVVNTTK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->ITT).", "chr_id": "NC_000018.10", "chr_pos": "7949263", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P28827-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase mu", "gene_name": "PTPRM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1452, "chemical_mass": 163682.0 } ] }, { "start_pos": "150", "site_seq": "CCGAAnYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAANYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAAnYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAANYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAAnYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAANYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "", "site_lbl": "N150", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->DYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "rs1167328183", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167328183" }, { "id": "rs1167328183", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1167328183#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->HYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "P08962", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08962" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->TYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAAnYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAANYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "", "site_lbl": "N150", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->DYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "rs1167328183", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167328183" }, { "id": "rs1167328183", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1167328183#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->HYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "P08962", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08962" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->TYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "", "site_lbl": "N248", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "15", "chr_pos": "39584027", "evidence": [ { "id": "rs1890162753", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1890162753" }, { "id": "rs1890162753", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1890162753#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "", "site_lbl": "N248", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "15", "chr_pos": "39584027", "evidence": [ { "id": "rs1890162753", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1890162753" }, { "id": "rs1890162753", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1890162753#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "486", "site_seq": "HnGTVECK", "site_lbl": "Asn486", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10721-1", "start_pos": 486, "end_pos": 486, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 976, "chemical_mass": 109865.0 } ] }, { "start_pos": "486", "site_seq": "N", "site_lbl": "Asn486", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10721-1", "start_pos": 486, "end_pos": 486, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 976, "chemical_mass": 109865.0 } ] }, { "start_pos": "486", "site_seq": "HnGTVECK", "site_lbl": "Asn486", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10721-1", "start_pos": 486, "end_pos": 486, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 976, "chemical_mass": 109865.0 } ] }, { "start_pos": "486", "site_seq": "N", "site_lbl": "Asn486", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10721-1", "start_pos": 486, "end_pos": 486, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 976, "chemical_mass": 109865.0 } ] }, { "start_pos": "486", "site_seq": "HnGTVECK", "site_lbl": "Asn486", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10721-1", "start_pos": 486, "end_pos": 486, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 976, "chemical_mass": 109865.0 } ] }, { "start_pos": "486", "site_seq": "N", "site_lbl": "Asn486", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10721-1", "start_pos": 486, "end_pos": 486, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 976, "chemical_mass": 109865.0 } ] }, { "start_pos": "486", "site_seq": "", "site_lbl": "N486", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->IGT).", "chr_id": "4", "chr_pos": "54725967", "evidence": [ { "id": "P10721", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P10721" }, { "id": "rs779134230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779134230" } ], "disease": [ { "disease_id": "DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx.", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "4", "chr_pos": "54725967", "evidence": [ { "id": "rs779134230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779134230" } ], "disease": [ { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] }, { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] }, { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] }, { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] }, { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] }, { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "4", "chr_pos": "54725967", "evidence": [ { "id": "rs779134230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779134230" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "4", "chr_pos": "54725966", "evidence": [ { "id": "rs2109769154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2109769154" }, { "id": "rs2109769154", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2109769154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10721-1", "start_pos": 486, "end_pos": 486, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 976, "chemical_mass": 109865.0 } ] }, { "start_pos": "486", "site_seq": "HnGTVECK", "site_lbl": "Asn486", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10721-1", "start_pos": 486, "end_pos": 486, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 976, "chemical_mass": 109865.0 } ] }, { "start_pos": "486", "site_seq": "N", "site_lbl": "Asn486", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10721-1", "start_pos": 486, "end_pos": 486, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 976, "chemical_mass": 109865.0 } ] }, { "start_pos": "486", "site_seq": "", "site_lbl": "N486", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->IGT).", "chr_id": "4", "chr_pos": "54725967", "evidence": [ { "id": "P10721", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P10721" }, { "id": "rs779134230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779134230" } ], "disease": [ { "disease_id": "DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx.", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "4", "chr_pos": "54725967", "evidence": [ { "id": "rs779134230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779134230" } ], "disease": [ { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] }, { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] }, { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] }, { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] }, { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] }, { "disease_id": "DOID:9253", "name": "gastrointestinal stromal tumor", "description": "", "url": "http://disease-ontology.org/term/DOID:9253", "evidence": [ { "id": "9253", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9253" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "4", "chr_pos": "54725967", "evidence": [ { "id": "rs779134230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230" }, { "id": "rs779134230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779134230" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "4", "chr_pos": "54725966", "evidence": [ { "id": "rs2109769154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2109769154" }, { "id": "rs2109769154", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2109769154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10721-1", "start_pos": 486, "end_pos": 486, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 976, "chemical_mass": 109865.0 } ] }, { "start_pos": "2236", "site_seq": "LVLGTPQSNSPFGAAVGEQnETLIR", "site_lbl": "Asn2236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 2236, "end_pos": 2236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "2236", "site_seq": "LVLGTPQSNSPFGAAVGEQNETLIR", "site_lbl": "Asn2236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 2236, "end_pos": 2236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "2236", "site_seq": "LVLGTPQSNSPFGAAVGEQnETLIR", "site_lbl": "Asn2236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 2236, "end_pos": 2236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "2236", "site_seq": "LVLGTPQSNSPFGAAVGEQNETLIR", "site_lbl": "Asn2236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 2236, "end_pos": 2236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "2236", "site_seq": "LVLGTPQSNSPFGAAVGEQnETLIR", "site_lbl": "Asn2236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 2236, "end_pos": 2236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "2236", "site_seq": "LVLGTPQSNSPFGAAVGEQNETLIR", "site_lbl": "Asn2236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 2236, "end_pos": 2236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "2236", "site_seq": "", "site_lbl": "N2236", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "13", "chr_pos": "38851074", "evidence": [ { "id": "rs1460003003", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460003003" }, { "id": "rs1460003003", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1460003003" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "13", "chr_pos": "38851073", "evidence": [ { "id": "rs770788791", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770788791" }, { "id": "rs770788791", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770788791" }, { "id": "rs770788791", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770788791" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 2236, "end_pos": 2236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "2236", "site_seq": "LVLGTPQSNSPFGAAVGEQnETLIR", "site_lbl": "Asn2236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 2236, "end_pos": 2236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "2236", "site_seq": "LVLGTPQSNSPFGAAVGEQNETLIR", "site_lbl": "Asn2236", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 2236, "end_pos": 2236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "2236", "site_seq": "", "site_lbl": "N2236", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "13", "chr_pos": "38851074", "evidence": [ { "id": "rs1460003003", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460003003" }, { "id": "rs1460003003", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1460003003" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "13", "chr_pos": "38851073", "evidence": [ { "id": "rs770788791", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770788791" }, { "id": "rs770788791", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770788791" }, { "id": "rs770788791", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770788791" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 2236, "end_pos": 2236, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "42", "site_seq": "HEnTSSSPIQYEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "42", "site_seq": "HEnTSSSPIQYEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "42", "site_seq": "HEnTSSSPIQYEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "42", "site_seq": "HEnTSSSPIQYEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04216-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "THY1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 161, "chemical_mass": 17935.0 } ] }, { "start_pos": "50", "site_seq": "LnFTGPGDPDSIR", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "N", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "LNFTGPGDPDSIR", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "LnFTGPGDPDSIR", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "N", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "LNFTGPGDPDSIR", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "LnFTGPGDPDSIR", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "N", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "LNFTGPGDPDSIR", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "", "site_lbl": "N50", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->YFT).", "chr_id": "21", "chr_pos": "44907095", "evidence": [ { "id": "rs199810704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199810704" }, { "id": "rs199810704", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs199810704" }, { "id": "rs199810704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199810704" }, { "id": "rs199810704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199810704" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "LnFTGPGDPDSIR", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "N", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "LNFTGPGDPDSIR", "site_lbl": "Asn50", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "50", "site_seq": "", "site_lbl": "N50", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->YFT).", "chr_id": "21", "chr_pos": "44907095", "evidence": [ { "id": "rs199810704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199810704" }, { "id": "rs199810704", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs199810704" }, { "id": "rs199810704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199810704" }, { "id": "rs199810704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199810704" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05107-1", "start_pos": 50, "end_pos": 50, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 769, "chemical_mass": 84791.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] } ], "record_id": "G02528FI" }