{ "glytoucan_ac": "G02315DX", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "392", "url": "https://glyconnect.expasy.org/browser/compositions/392" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "392", "url": "https://glyconnect.expasy.org/browser/compositions/392" }, { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "392", "url": "https://glyconnect.expasy.org/browser/compositions/392" }, { "database": "PubMed", "id": "32363391", "url": "https://glygen.org/publication/PubMed/32363391" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" } ], "mass": 2499.9, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Tetraantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Triantennary" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 0, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 6, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 6, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 1, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "NC_000004.12", "chr_pos": "70657267", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "4", "chr_pos": "70657268", "evidence": [ { "id": "rs924730867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs924730867" }, { "id": "rs924730867", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs924730867#frequency_tab" }, { "id": "rs924730867", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs924730867" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "EnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "N", "site_lbl": "N71", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "IIVPLNNREnISDPTSPLR", "site_lbl": "Asn71", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "71", "site_seq": "", "site_lbl": "N71", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->KIS).", "chr_id": "NC_000004.12", "chr_pos": "70657267", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "4", "chr_pos": "70657268", "evidence": [ { "id": "rs924730867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs924730867" }, { "id": "rs924730867", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs924730867#frequency_tab" }, { "id": "rs924730867", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs924730867" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01591-1", "start_pos": 71, "end_pos": 71, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "277", "url": "https://glyconnect.expasy.org/browser/proteins/277" } ], "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 159, "chemical_mass": 18099.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "", "site_lbl": "N282", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "", "site_lbl": "N282", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1019", "url": "https://glyconnect.expasy.org/browser/proteins/1019" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1042", "url": "https://glyconnect.expasy.org/browser/proteins/1042" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADNQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADnQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADNQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADnQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADNQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADnQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "N", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADNQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1703", "site_seq": "NYYADnQTCDGELLFNMTK", "site_lbl": "Asn1703", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1703, "end_pos": 1703, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "291", "site_seq": "N", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1242", "url": "https://glyconnect.expasy.org/browser/proteins/1242" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "291", "site_seq": "N", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1242", "url": "https://glyconnect.expasy.org/browser/proteins/1242" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "291", "site_seq": "N", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1242", "url": "https://glyconnect.expasy.org/browser/proteins/1242" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "291", "site_seq": "", "site_lbl": "N291", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "1", "chr_pos": "203347400", "evidence": [ { "id": "rs747268376", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747268376" }, { "id": "rs747268376", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747268376" }, { "id": "rs747268376", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747268376" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1242", "url": "https://glyconnect.expasy.org/browser/proteins/1242" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "291", "site_seq": "N", "site_lbl": "Asn291", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1242", "url": "https://glyconnect.expasy.org/browser/proteins/1242" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "291", "site_seq": "", "site_lbl": "N291", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "1", "chr_pos": "203347400", "evidence": [ { "id": "rs747268376", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747268376" }, { "id": "rs747268376", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747268376" }, { "id": "rs747268376", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747268376" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q06828-1", "start_pos": 291, "end_pos": 291, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1242", "url": "https://glyconnect.expasy.org/browser/proteins/1242" } ], "protein_name": "Fibromodulin", "gene_name": "FMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 376, "chemical_mass": 43179.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1470", "url": "https://glyconnect.expasy.org/browser/proteins/1470" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "2", "chr_pos": "215420764", "evidence": [ { "id": "rs528350304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528350304#frequency_tab" }, { "id": "rs528350304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528350304" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "2", "chr_pos": "215420764", "evidence": [ { "id": "rs528350304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528350304#frequency_tab" }, { "id": "rs528350304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528350304" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "161", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "7", "chr_pos": "143139186", "evidence": [ { "id": "rs1423561145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423561145" }, { "id": "rs1423561145", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1423561145#frequency_tab" }, { "id": "rs1423561145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1423561145" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "TFYWDFYTnR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "7", "chr_pos": "143139186", "evidence": [ { "id": "rs1423561145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423561145" }, { "id": "rs1423561145", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1423561145#frequency_tab" }, { "id": "rs1423561145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1423561145" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12273-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1636", "url": "https://glyconnect.expasy.org/browser/proteins/1636" } ], "protein_name": "Prolactin-inducible protein", "gene_name": "PIP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 146, "chemical_mass": 16572.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "6", "chr_pos": "7301446", "evidence": [ { "id": "P43307", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P43307" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "N", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "YPQDYQFYIQnFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR", "site_lbl": "Asn136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "136", "site_seq": "", "site_lbl": "N136", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "6", "chr_pos": "7301446", "evidence": [ { "id": "P43307", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P43307" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P43307-1", "start_pos": 136, "end_pos": 136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1839", "url": "https://glyconnect.expasy.org/browser/proteins/1839" } ], "protein_name": "Translocon-associated protein subunit alpha", "gene_name": "SSR1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 286, "chemical_mass": 32235.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIKYLDFVFAVK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "WQMnFTVR", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "N", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "WQMNFTVR", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIKYLDFVFAVK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "WQMnFTVR", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "N", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "WQMNFTVR", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIKYLDFVFAVK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "WQMnFTVR", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "N", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "WQMNFTVR", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "", "site_lbl": "N275", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "X", "chr_pos": "120446346", "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "X", "chr_pos": "120446346", "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "X", "chr_pos": "120446345", "evidence": [ { "id": "rs397516747", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs397516747" }, { "id": "rs397516747", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs397516747#frequency_tab" }, { "id": "rs397516747", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs397516747" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "", "site_lbl": "N356", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "X", "chr_pos": "120441756", "evidence": [ { "id": "rs775416221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775416221" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "LnSSTIKYLDFVFAVK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "WQMnFTVR", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "N", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "49", "site_seq": "WQMNFTVR", "site_lbl": "Asn49", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 49, "end_pos": 49, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "275", "site_seq": "", "site_lbl": "N275", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "X", "chr_pos": "120446346", "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "X", "chr_pos": "120446346", "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "X", "chr_pos": "120446345", "evidence": [ { "id": "rs397516747", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs397516747" }, { "id": "rs397516747", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs397516747#frequency_tab" }, { "id": "rs397516747", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs397516747" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "", "site_lbl": "N356", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "X", "chr_pos": "120441756", "evidence": [ { "id": "rs775416221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775416221" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "N374", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "NC_000008.11", "chr_pos": "27599822", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "N374", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "NC_000008.11", "chr_pos": "27599822", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-354. Decreases secretion; when associated with Q-291 and Q-354.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "", "site_lbl": "N513", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "16", "chr_pos": "20341131", "evidence": [ { "id": "P07911", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07911" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "FALLMTNCYATPSSnATDPLK", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "N", "site_lbl": "Asn513", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "513", "site_seq": "", "site_lbl": "N513", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "16", "chr_pos": "20341131", "evidence": [ { "id": "P07911", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07911" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 513, "end_pos": 513, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "", "site_lbl": "N78", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "9", "chr_pos": "136979111", "evidence": [ { "id": "P41222", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P41222" }, { "id": "rs750840590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750840590" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "SVVAPATDGGLnLTSTFLRK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "78", "site_seq": "", "site_lbl": "N78", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "9", "chr_pos": "136979111", "evidence": [ { "id": "P41222", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P41222" }, { "id": "rs750840590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750840590" }, { "id": "rs750840590", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750840590" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P41222-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "685", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 190, "chemical_mass": 21029.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "", "site_lbl": "N43", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "11", "chr_pos": "33717411", "evidence": [ { "id": "rs1351382260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351382260" }, { "id": "rs1351382260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351382260#frequency_tab" }, { "id": "rs1351382260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351382260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "", "site_lbl": "N43", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "11", "chr_pos": "33717411", "evidence": [ { "id": "rs1351382260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351382260" }, { "id": "rs1351382260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351382260#frequency_tab" }, { "id": "rs1351382260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351382260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47710-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2932", "url": "https://glyconnect.expasy.org/browser/proteins/2932" } ], "protein_name": "Alpha-S1-casein", "gene_name": "CSN1S1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 185, "chemical_mass": 21671.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47710-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2932", "url": "https://glyconnect.expasy.org/browser/proteins/2932" } ], "protein_name": "Alpha-S1-casein", "gene_name": "CSN1S1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 185, "chemical_mass": 21671.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47710-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2932", "url": "https://glyconnect.expasy.org/browser/proteins/2932" } ], "protein_name": "Alpha-S1-casein", "gene_name": "CSN1S1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 185, "chemical_mass": 21671.0 } ] }, { "start_pos": "69", "site_seq": "N", "site_lbl": "Asn69", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P47710-1", "start_pos": 69, "end_pos": 69, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "2932", "url": "https://glyconnect.expasy.org/browser/proteins/2932" } ], "protein_name": "Alpha-S1-casein", "gene_name": "CSN1S1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 185, "chemical_mass": 21671.0 } ] }, { "start_pos": "499", "site_seq": "WnNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "N", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WNNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WnNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "N", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WNNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WnNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "N", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WNNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WnNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "N", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WNNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" }, { "database": "GlyConnect", "id": "550", "url": "https://glyconnect.expasy.org/browser/proteins/550" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "160", "site_seq": "TQLTCSLNSSGVDIVGHR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "160", "site_seq": "TQLTCSLNSSGVDIVGHR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "160", "site_seq": "TQLTCSLNSSGVDIVGHR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "160", "site_seq": "", "site_lbl": "N160", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "10", "chr_pos": "79545569", "evidence": [ { "id": "rs3389123065", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389123065" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "160", "site_seq": "TQLTCSLNSSGVDIVGHR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "160", "site_seq": "", "site_lbl": "N160", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "10", "chr_pos": "79545569", "evidence": [ { "id": "rs3389123065", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389123065" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P18572-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2147", "url": "https://glyconnect.expasy.org/browser/proteins/2147" } ], "protein_name": "Basigin", "gene_name": "Bsg", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 389, "chemical_mass": 42445.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32363391", "url": "https://glygen.org/publication/PubMed/32363391" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32363391", "url": "https://glygen.org/publication/PubMed/32363391" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32363391", "url": "https://glygen.org/publication/PubMed/32363391" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32363391", "url": "https://glygen.org/publication/PubMed/32363391" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2838", "url": "https://glyconnect.expasy.org/browser/proteins/2838" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] } ], "record_id": "G02315DX" }