{ "glytoucan_ac": "G01485JJ", "species": [ { "taxid": 9913, "name": "Bos taurus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G00176HZ", "url": "https://www.glygen.org/glycan/G00176HZ" }, { "database": "Subsumption", "id": "G09666WO", "url": "https://www.glygen.org/glycan/G09666WO" }, { "database": "Subsumption", "id": "G26275JI", "url": "https://www.glygen.org/glycan/G26275JI" }, { "database": "Subsumption", "id": "G31146VU", "url": "https://www.glygen.org/glycan/G31146VU" }, { "database": "Subsumption", "id": "G52477OC", "url": "https://www.glygen.org/glycan/G52477OC" }, { "database": "Subsumption", "id": "G57787IU", "url": "https://www.glygen.org/glycan/G57787IU" }, { "database": "Subsumption", "id": "G60653VD", "url": "https://www.glygen.org/glycan/G60653VD" }, { "database": "Subsumption", "id": "G78555BT", "url": "https://www.glygen.org/glycan/G78555BT" }, { "database": "Subsumption", "id": "G85542KD", "url": "https://www.glygen.org/glycan/G85542KD" }, { "database": "Subsumption", "id": "G89285QP", "url": "https://www.glygen.org/glycan/G89285QP" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" }, { "taxid": 9031, "name": "Gallus gallus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G00176HZ", "url": "https://www.glygen.org/glycan/G00176HZ" }, { "database": "Subsumption", "id": "G22562DG", "url": "https://www.glygen.org/glycan/G22562DG" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G00176HZ", "url": "https://www.glygen.org/glycan/G00176HZ" }, { "database": "Subsumption", "id": "G09666WO", "url": "https://www.glygen.org/glycan/G09666WO" }, { "database": "Subsumption", "id": "G57787IU", "url": "https://www.glygen.org/glycan/G57787IU" }, { "database": "Subsumption", "id": "G60653VD", "url": "https://www.glygen.org/glycan/G60653VD" }, { "database": "Subsumption", "id": "G85542KD", "url": "https://www.glygen.org/glycan/G85542KD" }, { "database": "Subsumption", "id": "G89285QP", "url": "https://www.glygen.org/glycan/G89285QP" }, { "database": "Subsumption", "id": "G49369WH", "url": "https://www.glygen.org/glycan/G49369WH" }, { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000888", "url": "https://data.glygen.org/GLY_000888" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G00176HZ", "url": "https://www.glygen.org/glycan/G00176HZ" }, { "database": "Subsumption", "id": "G83710ZZ", "url": "https://www.glygen.org/glycan/G83710ZZ" }, { "database": "Subsumption", "id": "G99952ON", "url": "https://www.glygen.org/glycan/G99952ON" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" }, { "taxid": 9823, "name": "Sus scrofa", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G60653VD", "url": "https://www.glygen.org/glycan/G60653VD" }, { "database": "Subsumption", "id": "G85542KD", "url": "https://www.glygen.org/glycan/G85542KD" }, { "database": "Subsumption", "id": "G49369WH", "url": "https://www.glygen.org/glycan/G49369WH" }, { "database": "Subsumption", "id": "G04508HC", "url": "https://www.glygen.org/glycan/G04508HC" }, { "database": "Subsumption", "id": "G74575XC", "url": "https://www.glygen.org/glycan/G74575XC" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "both", "evidence": [ { "database": "Subsumption", "id": "G85542KD", "url": "https://www.glygen.org/glycan/G85542KD" }, { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 10029, "name": "Cricetulus griseus", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G49369WH", "url": "https://www.glygen.org/glycan/G49369WH" } ], "common_name": "Chinese hamster", "glygen_name": "Hamster", "reference_species": "Cricetulus griseus [10029]" } ], "mass": 1868.7, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Tetraantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Triantennary" } }, { "type": { "name": "O-linked", "url": "" }, "subtype": { "name": "Core 3", "url": "" } }, { "type": { "name": "O-linked", "url": "" }, "subtype": { "name": "Core 6", "url": "" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 1, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 3, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 6, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "373", "site_seq": "FLSYNVTR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYnVTR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYnVTRR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "N", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYNVTR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYnVTR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYnVTRR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "N", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYNVTR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYnVTR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYnVTRR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "N", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "", "site_lbl": "N373", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "3", "chr_pos": "119492377", "evidence": [ { "id": "rs187183254", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs187183254" }, { "id": "rs187183254", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs187183254" }, { "id": "rs187183254", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs187183254" }, { "id": "rs187183254", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs187183254#frequency_tab" }, { "id": "rs187183254", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs187183254" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYNVTR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYnVTR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "FLSYnVTRR", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "N", "site_lbl": "Asn373", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "373", "site_seq": "", "site_lbl": "N373", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "3", "chr_pos": "119492377", "evidence": [ { "id": "rs187183254", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs187183254" }, { "id": "rs187183254", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs187183254" }, { "id": "rs187183254", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs187183254" }, { "id": "rs187183254", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs187183254#frequency_tab" }, { "id": "rs187183254", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs187183254" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NBL1-1", "start_pos": 373, "end_pos": 373, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Protein O-glucosyltransferase 1", "gene_name": "POGLUT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 392, "chemical_mass": 46189.0 } ] }, { "start_pos": "490", "site_seq": "VALVNDSLSDVTSTTSSR", "site_lbl": "Asn490", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z2W4-1", "start_pos": 490, "end_pos": 490, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Zinc finger CCCH-type antiviral protein 1", "gene_name": "ZC3HAV1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 902, "chemical_mass": 101431.0 } ] }, { "start_pos": "490", "site_seq": "VALVNDSLSDVTSTTSSR", "site_lbl": "Asn490", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z2W4-1", "start_pos": 490, "end_pos": 490, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Zinc finger CCCH-type antiviral protein 1", "gene_name": "ZC3HAV1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 902, "chemical_mass": 101431.0 } ] }, { "start_pos": "490", "site_seq": "VALVNDSLSDVTSTTSSR", "site_lbl": "Asn490", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z2W4-1", "start_pos": 490, "end_pos": 490, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Zinc finger CCCH-type antiviral protein 1", "gene_name": "ZC3HAV1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 902, "chemical_mass": 101431.0 } ] }, { "start_pos": "490", "site_seq": "", "site_lbl": "N490", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "7", "chr_pos": "139079471", "evidence": [ { "id": "rs769047637", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769047637" }, { "id": "rs769047637", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769047637" }, { "id": "rs769047637", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769047637#frequency_tab" }, { "id": "rs769047637", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769047637" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "7", "chr_pos": "139079472", "evidence": [ { "id": "rs775045266", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775045266" }, { "id": "rs775045266", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775045266" }, { "id": "rs775045266", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775045266#frequency_tab" }, { "id": "rs775045266", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775045266" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z2W4-1", "start_pos": 490, "end_pos": 490, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Zinc finger CCCH-type antiviral protein 1", "gene_name": "ZC3HAV1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 902, "chemical_mass": 101431.0 } ] }, { "start_pos": "490", "site_seq": "VALVNDSLSDVTSTTSSR", "site_lbl": "Asn490", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z2W4-1", "start_pos": 490, "end_pos": 490, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Zinc finger CCCH-type antiviral protein 1", "gene_name": "ZC3HAV1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 902, "chemical_mass": 101431.0 } ] }, { "start_pos": "490", "site_seq": "", "site_lbl": "N490", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "7", "chr_pos": "139079471", "evidence": [ { "id": "rs769047637", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769047637" }, { "id": "rs769047637", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769047637" }, { "id": "rs769047637", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769047637#frequency_tab" }, { "id": "rs769047637", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769047637" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "7", "chr_pos": "139079472", "evidence": [ { "id": "rs775045266", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775045266" }, { "id": "rs775045266", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775045266" }, { "id": "rs775045266", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775045266#frequency_tab" }, { "id": "rs775045266", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775045266" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q7Z2W4-1", "start_pos": 490, "end_pos": 490, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Zinc finger CCCH-type antiviral protein 1", "gene_name": "ZC3HAV1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 902, "chemical_mass": 101431.0 } ] }, { "start_pos": "313", "site_seq": "HEGQEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQR", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "N", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "HEGQEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQR", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "N", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "HEGQEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQR", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "N", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "", "site_lbl": "N313", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->nullES).", "chr_id": "11", "chr_pos": "6616451_6616452", "evidence": [ { "id": "rs886041487", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs886041487" } ], "disease": [ { "disease_id": "DOID:0110726", "name": "neuronal ceroid lipofuscinosis 2", "description": "A neuronal ceroid lipofuscinosis that is characterized by 'curvilinear' profile lipopigment pattern and has_material_basis_in homozygous or compound heterozygous mutation in the TPP1 gene on chromosome 11p15.", "url": "http://disease-ontology.org/term/DOID:0110726", "evidence": [ { "id": "204500", "database": "MIM", "url": "https://www.omim.org/entry/204500" }, { "id": "0110726", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110726" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "HEGQEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQR", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "N", "site_lbl": "Asn313", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "313", "site_seq": "", "site_lbl": "N313", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->nullES).", "chr_id": "11", "chr_pos": "6616451_6616452", "evidence": [ { "id": "rs886041487", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs886041487" } ], "disease": [ { "disease_id": "DOID:0110726", "name": "neuronal ceroid lipofuscinosis 2", "description": "A neuronal ceroid lipofuscinosis that is characterized by 'curvilinear' profile lipopigment pattern and has_material_basis_in homozygous or compound heterozygous mutation in the TPP1 gene on chromosome 11p15.", "url": "http://disease-ontology.org/term/DOID:0110726", "evidence": [ { "id": "204500", "database": "MIM", "url": "https://www.omim.org/entry/204500" }, { "id": "0110726", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110726" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14773-1", "start_pos": 313, "end_pos": 313, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Tripeptidyl-peptidase 1", "gene_name": "TPP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 563, "chemical_mass": 61248.0 } ] }, { "start_pos": "158", "site_seq": "LDWLGNCSGLNDDSYGYR", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14094-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 35195.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14094-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 35195.0 } ] }, { "start_pos": "158", "site_seq": "LDWLGNCSGLNDDSYGYR", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14094-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 35195.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14094-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 35195.0 } ] }, { "start_pos": "158", "site_seq": "LDWLGNCSGLNDDSYGYR", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14094-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 35195.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14094-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 35195.0 } ] }, { "start_pos": "158", "site_seq": "LDWLGNCSGLNDDSYGYR", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14094-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 35195.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14094-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 304, "chemical_mass": 35195.0 } ] }, { "start_pos": "98", "site_seq": "INADPVLLPNITLGSEIR", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97772-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glutamate receptor 1", "gene_name": "Grm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1199, "chemical_mass": 133212.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97772-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glutamate receptor 1", "gene_name": "Grm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1199, "chemical_mass": 133212.0 } ] }, { "start_pos": "98", "site_seq": "INADPVLLPNITLGSEIR", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97772-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glutamate receptor 1", "gene_name": "Grm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1199, "chemical_mass": 133212.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97772-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glutamate receptor 1", "gene_name": "Grm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1199, "chemical_mass": 133212.0 } ] }, { "start_pos": "98", "site_seq": "INADPVLLPNITLGSEIR", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97772-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glutamate receptor 1", "gene_name": "Grm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1199, "chemical_mass": 133212.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97772-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glutamate receptor 1", "gene_name": "Grm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1199, "chemical_mass": 133212.0 } ] }, { "start_pos": "98", "site_seq": "INADPVLLPNITLGSEIR", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97772-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glutamate receptor 1", "gene_name": "Grm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1199, "chemical_mass": 133212.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97772-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Metabotropic glutamate receptor 1", "gene_name": "Grm1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1199, "chemical_mass": 133212.0 } ] }, { "start_pos": "720", "site_seq": "QGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSK", "site_lbl": "Asn720", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VDN2-1", "start_pos": 720, "end_pos": 720, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-1", "gene_name": "Atp1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1023, "chemical_mass": 112982.0 } ] }, { "start_pos": "720", "site_seq": "QGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSK", "site_lbl": "Asn720", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VDN2-1", "start_pos": 720, "end_pos": 720, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-1", "gene_name": "Atp1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1023, "chemical_mass": 112982.0 } ] }, { "start_pos": "720", "site_seq": "QGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSK", "site_lbl": "Asn720", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VDN2-1", "start_pos": 720, "end_pos": 720, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-1", "gene_name": "Atp1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1023, "chemical_mass": 112982.0 } ] }, { "start_pos": "720", "site_seq": "QGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSK", "site_lbl": "Asn720", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8VDN2-1", "start_pos": 720, "end_pos": 720, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-1", "gene_name": "Atp1a1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1023, "chemical_mass": 112982.0 } ] }, { "start_pos": "192", "site_seq": "PAAQISWTPDGDCVTTSESHSNGTVTVR", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BTP3-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell surface glycoprotein CD200 receptor 5", "gene_name": "Cd200r5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 270, "chemical_mass": 29528.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BTP3-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell surface glycoprotein CD200 receptor 5", "gene_name": "Cd200r5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 270, "chemical_mass": 29528.0 } ] }, { "start_pos": "192", "site_seq": "PAAQISWTPDGDCVTTSESHSNGTVTVR", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BTP3-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell surface glycoprotein CD200 receptor 5", "gene_name": "Cd200r5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 270, "chemical_mass": 29528.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BTP3-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell surface glycoprotein CD200 receptor 5", "gene_name": "Cd200r5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 270, "chemical_mass": 29528.0 } ] }, { "start_pos": "192", "site_seq": "PAAQISWTPDGDCVTTSESHSNGTVTVR", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BTP3-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell surface glycoprotein CD200 receptor 5", "gene_name": "Cd200r5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 270, "chemical_mass": 29528.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BTP3-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell surface glycoprotein CD200 receptor 5", "gene_name": "Cd200r5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 270, "chemical_mass": 29528.0 } ] }, { "start_pos": "192", "site_seq": "PAAQISWTPDGDCVTTSESHSNGTVTVR", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BTP3-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell surface glycoprotein CD200 receptor 5", "gene_name": "Cd200r5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 270, "chemical_mass": 29528.0 } ] }, { "start_pos": "192", "site_seq": "N", "site_lbl": "Asn192", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8BTP3-1", "start_pos": 192, "end_pos": 192, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Cell surface glycoprotein CD200 receptor 5", "gene_name": "Cd200r5", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 270, "chemical_mass": 29528.0 } ] }, { "start_pos": "87", "site_seq": "GAPGVSVDMNITYMSPAK", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQR4-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Acyl-coenzyme A thioesterase 13", "gene_name": "Acot13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 140, "chemical_mass": 15183.0 } ] }, { "start_pos": "87", "site_seq": "GAPGVSVDMNITYMSPAK", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQR4-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Acyl-coenzyme A thioesterase 13", "gene_name": "Acot13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 140, "chemical_mass": 15183.0 } ] }, { "start_pos": "87", "site_seq": "GAPGVSVDMNITYMSPAK", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQR4-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Acyl-coenzyme A thioesterase 13", "gene_name": "Acot13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 140, "chemical_mass": 15183.0 } ] }, { "start_pos": "87", "site_seq": "GAPGVSVDMNITYMSPAK", "site_lbl": "Asn87", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9CQR4-1", "start_pos": 87, "end_pos": 87, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Acyl-coenzyme A thioesterase 13", "gene_name": "Acot13", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 140, "chemical_mass": 15183.0 } ] }, { "start_pos": "295", "site_seq": "SANYTCVAISSLGMIEATAQVTVK", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2A8L5-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "Ptprf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1898, "chemical_mass": 211489.0 } ] }, { "start_pos": "295", "site_seq": "N", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2A8L5-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "Ptprf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1898, "chemical_mass": 211489.0 } ] }, { "start_pos": "295", "site_seq": "SANYTCVAISSLGMIEATAQVTVK", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2A8L5-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "Ptprf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1898, "chemical_mass": 211489.0 } ] }, { "start_pos": "295", "site_seq": "N", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2A8L5-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "Ptprf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1898, "chemical_mass": 211489.0 } ] }, { "start_pos": "295", "site_seq": "SANYTCVAISSLGMIEATAQVTVK", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2A8L5-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "Ptprf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1898, "chemical_mass": 211489.0 } ] }, { "start_pos": "295", "site_seq": "N", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2A8L5-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "Ptprf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1898, "chemical_mass": 211489.0 } ] }, { "start_pos": "295", "site_seq": "SANYTCVAISSLGMIEATAQVTVK", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2A8L5-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "Ptprf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1898, "chemical_mass": 211489.0 } ] }, { "start_pos": "295", "site_seq": "N", "site_lbl": "Asn295", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A2A8L5-1", "start_pos": 295, "end_pos": 295, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "Ptprf", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1898, "chemical_mass": 211489.0 } ] }, { "start_pos": "164", "site_seq": "VTSPnITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPNITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "GFIISnATYK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "GFIISNATYK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "GHTLVLnCTATTPLNTR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "N", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "GHTLVLNCTATTPLNTR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPnITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPNITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "GFIISnATYK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "GFIISNATYK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "GHTLVLnCTATTPLNTR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "N", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "GHTLVLNCTATTPLNTR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPnITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPNITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "GFIISnATYK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "GFIISNATYK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "GHTLVLnCTATTPLNTR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "N", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "GHTLVLNCTATTPLNTR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "", "site_lbl": "N164", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "13", "chr_pos": "28438243", "evidence": [ { "id": "P17948", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17948" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "13", "chr_pos": "28438242", "evidence": [ { "id": "P17948", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17948" }, { "id": "rs1387615627", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387615627" }, { "id": "rs1387615627", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387615627#frequency_tab" }, { "id": "rs1387615627", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1387615627" }, { "id": "rs1387615627", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1387615627" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "13", "chr_pos": "28438243", "evidence": [ { "id": "rs1290255117", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1290255117" }, { "id": "rs1290255117", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1290255117" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "", "site_lbl": "N196", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "13", "chr_pos": "28434148", "evidence": [ { "id": "P17948", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17948" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "", "site_lbl": "N251", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "13", "chr_pos": "28433881", "evidence": [ { "id": "rs772751830", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751830" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "13", "chr_pos": "28433881", "evidence": [ { "id": "rs772751830", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751830" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "13", "chr_pos": "28433880", "evidence": [ { "id": "rs767050810", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767050810" }, { "id": "rs767050810", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767050810" }, { "id": "rs767050810", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767050810#frequency_tab" }, { "id": "rs767050810", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767050810" }, { "id": "rs767050810", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs767050810" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->YCT).", "chr_id": "13", "chr_pos": "28433881", "evidence": [ { "id": "rs772751830", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751830" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPnITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPNITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "GFIISnATYK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "GFIISNATYK", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "GHTLVLnCTATTPLNTR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "N", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "GHTLVLNCTATTPLNTR", "site_lbl": "Asn251", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "", "site_lbl": "N164", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "13", "chr_pos": "28438243", "evidence": [ { "id": "P17948", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17948" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "13", "chr_pos": "28438242", "evidence": [ { "id": "P17948", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17948" }, { "id": "rs1387615627", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387615627" }, { "id": "rs1387615627", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387615627#frequency_tab" }, { "id": "rs1387615627", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1387615627" }, { "id": "rs1387615627", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1387615627" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "13", "chr_pos": "28438243", "evidence": [ { "id": "rs1290255117", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1290255117" }, { "id": "rs1290255117", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1290255117" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "196", "site_seq": "", "site_lbl": "N196", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "13", "chr_pos": "28434148", "evidence": [ { "id": "P17948", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17948" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "251", "site_seq": "", "site_lbl": "N251", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "13", "chr_pos": "28433881", "evidence": [ { "id": "rs772751830", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751830" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "13", "chr_pos": "28433881", "evidence": [ { "id": "rs772751830", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751830" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "13", "chr_pos": "28433880", "evidence": [ { "id": "rs767050810", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767050810" }, { "id": "rs767050810", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767050810" }, { "id": "rs767050810", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767050810#frequency_tab" }, { "id": "rs767050810", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767050810" }, { "id": "rs767050810", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs767050810" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->YCT).", "chr_id": "13", "chr_pos": "28433881", "evidence": [ { "id": "rs772751830", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772751830" }, { "id": "rs772751830", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772751830" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 251, "end_pos": 251, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "", "site_lbl": "N1223", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "1", "chr_pos": "183132500", "evidence": [ { "id": "rs892534215", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs892534215" }, { "id": "rs892534215", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs892534215#frequency_tab" }, { "id": "rs892534215", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs892534215" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "1", "chr_pos": "183132502", "evidence": [ { "id": "rs1571463550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1571463550" }, { "id": "rs1571463550", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1571463550#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "", "site_lbl": "N1241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "P11047", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P11047" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "", "site_lbl": "N1223", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "1", "chr_pos": "183132500", "evidence": [ { "id": "rs892534215", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs892534215" }, { "id": "rs892534215", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs892534215#frequency_tab" }, { "id": "rs892534215", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs892534215" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "1", "chr_pos": "183132502", "evidence": [ { "id": "rs1571463550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1571463550" }, { "id": "rs1571463550", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1571463550#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "", "site_lbl": "N1241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "P11047", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P11047" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "215", "site_seq": "TnSTFVQALVEHVK", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnKTEK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "DnATEEEILVYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "DVVTAAGDMLKDNATEEEILVYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "215", "site_seq": "TnSTFVQALVEHVK", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnKTEK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "DnATEEEILVYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "DVVTAAGDMLKDNATEEEILVYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "215", "site_seq": "TnSTFVQALVEHVK", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnKTEK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "DnATEEEILVYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "DVVTAAGDMLKDNATEEEILVYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "215", "site_seq": "", "site_lbl": "N215", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->HST).", "chr_id": "10", "chr_pos": "71828091", "evidence": [ { "id": "rs121918107", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918107" }, { "id": "rs121918107", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs121918107" }, { "id": "10682309", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10682309" }, { "id": "17561962", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17561962" } ], "disease": [ { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "10", "chr_pos": "71828089", "evidence": [ { "id": "rs770171865", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770171865" }, { "id": "rs770171865", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770171865" }, { "id": "rs770171865", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770171865" } ], "disease": [ { "disease_id": "DOID:0111330", "name": "combined saposin deficiency", "description": "A sphingolipidosis characterized by absence of expression of both isoforms of PSAP (SAP1 and SAP2) resulting in hepatosplenomegaly and severe neurological disease that has_material_basis_in homozygous or compound heterozygous mutation in PSAP on 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0111330", "evidence": [ { "id": "0111330", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111330" } ] }, { "disease_id": "DOID:0111330", "name": "combined saposin deficiency", "description": "A sphingolipidosis characterized by absence of expression of both isoforms of PSAP (SAP1 and SAP2) resulting in hepatosplenomegaly and severe neurological disease that has_material_basis_in homozygous or compound heterozygous mutation in PSAP on 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0111330", "evidence": [ { "id": "0111330", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111330" } ] }, { "disease_id": "DOID:0111330", "name": "combined saposin deficiency", "description": "A sphingolipidosis characterized by absence of expression of both isoforms of PSAP (SAP1 and SAP2) resulting in hepatosplenomegaly and severe neurological disease that has_material_basis_in homozygous or compound heterozygous mutation in PSAP on 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0111330", "evidence": [ { "id": "0111330", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111330" } ] }, { "disease_id": "DOID:0110961", "name": "atypical Gaucher's disease due to saposin c deficiency", "description": "A Gaucher's disease that has_material_basis_in compound heterozygous mutation in the PSAP gene on chromosome 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0110961", "evidence": [ { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" }, { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" } ] }, { "disease_id": "DOID:0110961", "name": "atypical Gaucher's disease due to saposin c deficiency", "description": "A Gaucher's disease that has_material_basis_in compound heterozygous mutation in the PSAP gene on chromosome 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0110961", "evidence": [ { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" }, { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" } ] }, { "disease_id": "DOID:0110961", "name": "atypical Gaucher's disease due to saposin c deficiency", "description": "A Gaucher's disease that has_material_basis_in compound heterozygous mutation in the PSAP gene on chromosome 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0110961", "evidence": [ { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" }, { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "", "site_lbl": "N332", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "10", "chr_pos": "71820249", "evidence": [ { "id": "rs546727182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546727182" }, { "id": "rs546727182", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs546727182" }, { "id": "rs546727182", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546727182" }, { "id": "rs546727182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs546727182#frequency_tab" }, { "id": "rs546727182", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs546727182" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->nullKT).", "chr_id": "10", "chr_pos": "71820248TGT", "evidence": [ { "id": "rs751974432", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751974432" } ], "disease": [ { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "", "site_lbl": "N80", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "10", "chr_pos": "71831857", "evidence": [ { "id": "rs1842525967", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1842525967" }, { "id": "rs1842525967", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1842525967" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "10", "chr_pos": "71831856", "evidence": [ { "id": "rs570654892", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs570654892" }, { "id": "rs570654892", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs570654892" }, { "id": "rs570654892", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs570654892" }, { "id": "rs570654892", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs570654892#frequency_tab" }, { "id": "rs570654892", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs570654892" } ], "disease": [ { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "215", "site_seq": "TnSTFVQALVEHVK", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnKTEK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "DnATEEEILVYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "DVVTAAGDMLKDNATEEEILVYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "215", "site_seq": "", "site_lbl": "N215", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->HST).", "chr_id": "10", "chr_pos": "71828091", "evidence": [ { "id": "rs121918107", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918107" }, { "id": "rs121918107", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs121918107" }, { "id": "10682309", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10682309" }, { "id": "17561962", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17561962" } ], "disease": [ { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "10", "chr_pos": "71828089", "evidence": [ { "id": "rs770171865", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770171865" }, { "id": "rs770171865", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770171865" }, { "id": "rs770171865", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770171865" } ], "disease": [ { "disease_id": "DOID:0111330", "name": "combined saposin deficiency", "description": "A sphingolipidosis characterized by absence of expression of both isoforms of PSAP (SAP1 and SAP2) resulting in hepatosplenomegaly and severe neurological disease that has_material_basis_in homozygous or compound heterozygous mutation in PSAP on 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0111330", "evidence": [ { "id": "0111330", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111330" } ] }, { "disease_id": "DOID:0111330", "name": "combined saposin deficiency", "description": "A sphingolipidosis characterized by absence of expression of both isoforms of PSAP (SAP1 and SAP2) resulting in hepatosplenomegaly and severe neurological disease that has_material_basis_in homozygous or compound heterozygous mutation in PSAP on 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0111330", "evidence": [ { "id": "0111330", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111330" } ] }, { "disease_id": "DOID:0111330", "name": "combined saposin deficiency", "description": "A sphingolipidosis characterized by absence of expression of both isoforms of PSAP (SAP1 and SAP2) resulting in hepatosplenomegaly and severe neurological disease that has_material_basis_in homozygous or compound heterozygous mutation in PSAP on 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0111330", "evidence": [ { "id": "0111330", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111330" } ] }, { "disease_id": "DOID:0110961", "name": "atypical Gaucher's disease due to saposin c deficiency", "description": "A Gaucher's disease that has_material_basis_in compound heterozygous mutation in the PSAP gene on chromosome 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0110961", "evidence": [ { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" }, { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" } ] }, { "disease_id": "DOID:0110961", "name": "atypical Gaucher's disease due to saposin c deficiency", "description": "A Gaucher's disease that has_material_basis_in compound heterozygous mutation in the PSAP gene on chromosome 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0110961", "evidence": [ { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" }, { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" } ] }, { "disease_id": "DOID:0110961", "name": "atypical Gaucher's disease due to saposin c deficiency", "description": "A Gaucher's disease that has_material_basis_in compound heterozygous mutation in the PSAP gene on chromosome 10q22.1.", "url": "http://disease-ontology.org/term/DOID:0110961", "evidence": [ { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" }, { "id": "0110961", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110961" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "", "site_lbl": "N332", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "10", "chr_pos": "71820249", "evidence": [ { "id": "rs546727182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546727182" }, { "id": "rs546727182", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs546727182" }, { "id": "rs546727182", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546727182" }, { "id": "rs546727182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs546727182#frequency_tab" }, { "id": "rs546727182", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs546727182" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->nullKT).", "chr_id": "10", "chr_pos": "71820248TGT", "evidence": [ { "id": "rs751974432", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751974432" } ], "disease": [ { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "80", "site_seq": "", "site_lbl": "N80", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "10", "chr_pos": "71831857", "evidence": [ { "id": "rs1842525967", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1842525967" }, { "id": "rs1842525967", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1842525967" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "10", "chr_pos": "71831856", "evidence": [ { "id": "rs570654892", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs570654892" }, { "id": "rs570654892", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs570654892" }, { "id": "rs570654892", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs570654892" }, { "id": "rs570654892", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs570654892#frequency_tab" }, { "id": "rs570654892", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs570654892" } ], "disease": [ { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] }, { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "307", "site_seq": "LLDGDLTSDPSYFQnVTGCSNYYNFLR", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGnQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "N", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGNQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "LLDGDLTSDPSYFQnVTGCSNYYNFLR", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGnQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "N", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGNQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "LLDGDLTSDPSYFQnVTGCSNYYNFLR", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGnQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "N", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGNQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "", "site_lbl": "N346", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "7", "chr_pos": "29064162", "evidence": [ { "id": "rs774430947", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774430947" }, { "id": "rs774430947", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774430947" }, { "id": "rs774430947", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774430947" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "7", "chr_pos": "29064161", "evidence": [ { "id": "rs535663848", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs535663848" }, { "id": "rs535663848", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs535663848" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "LLDGDLTSDPSYFQnVTGCSNYYNFLR", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGnQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "N", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "QAIHVGNQTFNDGTIVEK", "site_lbl": "Asn346", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "346", "site_seq": "", "site_lbl": "N346", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "7", "chr_pos": "29064162", "evidence": [ { "id": "rs774430947", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774430947" }, { "id": "rs774430947", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774430947" }, { "id": "rs774430947", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774430947" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "7", "chr_pos": "29064161", "evidence": [ { "id": "rs535663848", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs535663848" }, { "id": "rs535663848", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs535663848" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H3G5-1", "start_pos": 346, "end_pos": 346, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Probable serine carboxypeptidase CPVL", "gene_name": "CPVL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54164.0 } ] }, { "start_pos": "1069", "site_seq": "VVnSTTGTGEHLR", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "N", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "VVNSTTGTGEHLR", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "VVnSTTGTGEHLR", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "N", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "VVNSTTGTGEHLR", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "VVnSTTGTGEHLR", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "N", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "VVNSTTGTGEHLR", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "VVnSTTGTGEHLR", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "N", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1069", "site_seq": "VVNSTTGTGEHLR", "site_lbl": "Asn1069", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35442-1", "start_pos": 1069, "end_pos": 1069, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1172, "chemical_mass": 129991.0 } ] }, { "start_pos": "1144", "site_seq": "NCnSTETCQPSQFNCPNHR", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "NCNSTETCQPSQFNCPNHR", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "N", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "IYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "RIYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "N", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "RMLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDANNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "N", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "AWSDGSHLLPVInTTLGWPNGLAIDWAASR", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "N", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "NCnSTETCQPSQFNCPNHR", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "NCNSTETCQPSQFNCPNHR", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "N", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "IYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "RIYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "N", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "RMLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDANNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "N", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "AWSDGSHLLPVInTTLGWPNGLAIDWAASR", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "N", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "NCnSTETCQPSQFNCPNHR", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "NCNSTETCQPSQFNCPNHR", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "N", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "IYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "RIYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "N", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "RMLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDANNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "N", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "AWSDGSHLLPVInTTLGWPNGLAIDWAASR", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "N", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "", "site_lbl": "N1144", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->SST); n-glyco-sequon-gain (NCN->NCS).", "chr_id": "2", "chr_pos": "169243522", "evidence": [ { "id": "P98164", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98164" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "2", "chr_pos": "169244693", "evidence": [ { "id": "rs1689938007", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1689938007" }, { "id": "rs1689938007", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1689938007" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "", "site_lbl": "N2499", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "2", "chr_pos": "169206084", "evidence": [ { "id": "rs1688374769", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1688374769" }, { "id": "rs1688374769", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1688374769" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "2", "chr_pos": "169206082", "evidence": [ { "id": "rs764422443", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764422443" }, { "id": "rs764422443", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764422443" }, { "id": "rs764422443", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs764422443#frequency_tab" }, { "id": "rs764422443", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764422443" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "2", "chr_pos": "169206083", "evidence": [ { "id": "P98164", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98164" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "", "site_lbl": "N2809", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->HNT).", "chr_id": "2", "chr_pos": "169201655", "evidence": [ { "id": "rs768363457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768363457" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169201654", "evidence": [ { "id": "rs191087468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191087468" }, { "id": "rs191087468", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191087468" }, { "id": "rs191087468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs191087468#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "", "site_lbl": "N3315", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "2", "chr_pos": "169182222", "evidence": [ { "id": "rs2545747867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2545747867" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "2", "chr_pos": "169182220", "evidence": [ { "id": "rs201808907", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201808907" }, { "id": "rs201808907", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201808907" }, { "id": "rs201808907", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201808907#frequency_tab" }, { "id": "rs201808907", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201808907" } ], "disease": [ { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169182221", "evidence": [ { "id": "rs772442505", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772442505" }, { "id": "rs772442505", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772442505" }, { "id": "rs772442505", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772442505#frequency_tab" }, { "id": "rs772442505", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772442505" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "NCnSTETCQPSQFNCPNHR", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "NCNSTETCQPSQFNCPNHR", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "N", "site_lbl": "Asn1144", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "IYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "RIYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "N", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "RMLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDANNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "N", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "AWSDGSHLLPVInTTLGWPNGLAIDWAASR", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "866", "site_seq": "N", "site_lbl": "Asn866", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 866, "end_pos": 866, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1144", "site_seq": "", "site_lbl": "N1144", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->SST); n-glyco-sequon-gain (NCN->NCS).", "chr_id": "2", "chr_pos": "169243522", "evidence": [ { "id": "P98164", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98164" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "2", "chr_pos": "169244693", "evidence": [ { "id": "rs1689938007", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1689938007" }, { "id": "rs1689938007", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1689938007" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1144, "end_pos": 1144, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "", "site_lbl": "N2499", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "2", "chr_pos": "169206084", "evidence": [ { "id": "rs1688374769", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1688374769" }, { "id": "rs1688374769", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1688374769" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "2", "chr_pos": "169206082", "evidence": [ { "id": "rs764422443", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764422443" }, { "id": "rs764422443", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764422443" }, { "id": "rs764422443", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs764422443#frequency_tab" }, { "id": "rs764422443", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764422443" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "2", "chr_pos": "169206083", "evidence": [ { "id": "P98164", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98164" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "", "site_lbl": "N2809", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->HNT).", "chr_id": "2", "chr_pos": "169201655", "evidence": [ { "id": "rs768363457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768363457" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169201654", "evidence": [ { "id": "rs191087468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191087468" }, { "id": "rs191087468", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191087468" }, { "id": "rs191087468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs191087468#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "", "site_lbl": "N3315", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "2", "chr_pos": "169182222", "evidence": [ { "id": "rs2545747867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2545747867" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "2", "chr_pos": "169182220", "evidence": [ { "id": "rs201808907", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201808907" }, { "id": "rs201808907", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201808907" }, { "id": "rs201808907", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201808907#frequency_tab" }, { "id": "rs201808907", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201808907" } ], "disease": [ { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169182221", "evidence": [ { "id": "rs772442505", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772442505" }, { "id": "rs772442505", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772442505" }, { "id": "rs772442505", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772442505#frequency_tab" }, { "id": "rs772442505", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772442505" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDRELK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQNLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDRELK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQNLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDRELK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQNLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQnLTLIEESLTSEFIHDIDRELK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "285", "site_seq": "VTQNLTLIEESLTSEFIHDIDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P36955-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46312.0 } ] }, { "start_pos": "1041", "site_seq": "CVCNYLGTVQEHCnGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "N", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "KCVCNYLGTVQEHCNGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSnSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "N", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSNSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "CVCNYLGTVQEHCnGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "N", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "KCVCNYLGTVQEHCNGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSnSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "N", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSNSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "CVCNYLGTVQEHCnGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "N", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "KCVCNYLGTVQEHCNGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSnSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "N", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSNSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "", "site_lbl": "N1279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "7", "chr_pos": "107937203", "evidence": [ { "id": "rs2116343597", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2116343597" }, { "id": "rs2116343597", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2116343597" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "CVCNYLGTVQEHCnGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "N", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1041", "site_seq": "KCVCNYLGTVQEHCNGSDCQCDK", "site_lbl": "Asn1041", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1041, "end_pos": 1041, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSnSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "N", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "LSDTTSQSNSTAK", "site_lbl": "Asn1279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "1279", "site_seq": "", "site_lbl": "N1279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "7", "chr_pos": "107937203", "evidence": [ { "id": "rs2116343597", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2116343597" }, { "id": "rs2116343597", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2116343597" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07942-1", "start_pos": 1279, "end_pos": 1279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1786, "chemical_mass": 198038.0 } ] }, { "start_pos": "709", "site_seq": "QVYAnR", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "709", "site_seq": "N", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "709", "site_seq": "QVYAnR", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "709", "site_seq": "N", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "709", "site_seq": "QVYAnR", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "709", "site_seq": "N", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "709", "site_seq": "", "site_lbl": "N709", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->TRS).", "chr_id": "15", "chr_pos": "71746927", "evidence": [ { "id": "rs1368211558", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1368211558" }, { "id": "rs1368211558", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1368211558#frequency_tab" }, { "id": "rs1368211558", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1368211558" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "709", "site_seq": "QVYAnR", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "709", "site_seq": "N", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "709", "site_seq": "", "site_lbl": "N709", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->TRS).", "chr_id": "15", "chr_pos": "71746927", "evidence": [ { "id": "rs1368211558", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1368211558" }, { "id": "rs1368211558", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1368211558#frequency_tab" }, { "id": "rs1368211558", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1368211558" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMP0-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin type-1 domain-containing protein 4", "gene_name": "THSD4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1018, "chemical_mass": 112450.0 } ] }, { "start_pos": "145", "site_seq": "FYATnDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATNDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATnDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATNDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATnDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATNDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "20", "chr_pos": "45892473", "evidence": [ { "id": "rs1256294756", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1256294756" }, { "id": "rs1256294756", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1256294756" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATnDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "FYATNDTEVAQSNFEALQDFFR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "20", "chr_pos": "45892473", "evidence": [ { "id": "rs1256294756", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1256294756" }, { "id": "rs1256294756", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1256294756" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10619-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 480, "chemical_mass": 54466.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVnSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "VVNSTTGPGEHLR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Loss of N-glycosylation site.", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprotkb/P07996" }, { "database": "PubMed", "id": "15014436", "url": "https://glygen.org/publication/PubMed/15014436" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "GSFTSPGYPGTYPnNTYCEWVLVAPAGR", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "N", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "GSFTSPGYPGTYPnNTYCEWVLVAPAGR", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "N", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "GSFTSPGYPGTYPnNTYCEWVLVAPAGR", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "N", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "10", "chr_pos": "17127864", "evidence": [ { "id": "rs2492161163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2492161163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "", "site_lbl": "N2531", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "10", "chr_pos": "16907620", "evidence": [ { "id": "rs555761842", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs555761842" }, { "id": "rs555761842", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs555761842" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "", "site_lbl": "N3533", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "10", "chr_pos": "16828972", "evidence": [ { "id": "rs1838882476", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1838882476" }, { "id": "rs1838882476", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1838882476#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "", "site_lbl": "N781", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "10", "chr_pos": "17071930", "evidence": [ { "id": "rs149758972", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149758972#frequency_tab" }, { "id": "rs149758972", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149758972" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "GSFTSPGYPGTYPnNTYCEWVLVAPAGR", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "N", "site_lbl": "Asn3533", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "10", "chr_pos": "17127864", "evidence": [ { "id": "rs2492161163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2492161163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "", "site_lbl": "N2531", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "10", "chr_pos": "16907620", "evidence": [ { "id": "rs555761842", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs555761842" }, { "id": "rs555761842", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs555761842" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "3533", "site_seq": "", "site_lbl": "N3533", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "10", "chr_pos": "16828972", "evidence": [ { "id": "rs1838882476", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1838882476" }, { "id": "rs1838882476", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1838882476#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 3533, "end_pos": 3533, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "", "site_lbl": "N781", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "10", "chr_pos": "17071930", "evidence": [ { "id": "rs149758972", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149758972#frequency_tab" }, { "id": "rs149758972", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149758972" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "1645", "site_seq": "AFInGTGVETVVSADLPNAHGLAVDWVSR", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "N", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "AFINGTGVETVVSADLPNAHGLAVDWVSR", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "QTTAMDFSYAnETVCWVHVGDSAAQTQLK", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "N", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "QTTAMDFSYANETVCWVHVGDSAAQTQLK", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVnCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVNCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "N", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "AFInGTGVETVVSADLPNAHGLAVDWVSR", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "N", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "AFINGTGVETVVSADLPNAHGLAVDWVSR", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "QTTAMDFSYAnETVCWVHVGDSAAQTQLK", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "N", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "QTTAMDFSYANETVCWVHVGDSAAQTQLK", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVnCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVNCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "N", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "AFInGTGVETVVSADLPNAHGLAVDWVSR", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "N", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "AFINGTGVETVVSADLPNAHGLAVDWVSR", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "QTTAMDFSYAnETVCWVHVGDSAAQTQLK", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "N", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "QTTAMDFSYANETVCWVHVGDSAAQTQLK", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVnCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVNCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "N", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "", "site_lbl": "N239", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "12", "chr_pos": "57145365", "evidence": [ { "id": "rs772978789", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772978789" }, { "id": "rs772978789", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772978789" }, { "id": "rs772978789", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772978789#frequency_tab" }, { "id": "rs772978789", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772978789" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "AFInGTGVETVVSADLPNAHGLAVDWVSR", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "N", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "1645", "site_seq": "AFINGTGVETVVSADLPNAHGLAVDWVSR", "site_lbl": "Asn1645", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 1645, "end_pos": 1645, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "QTTAMDFSYAnETVCWVHVGDSAAQTQLK", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "N", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "QTTAMDFSYANETVCWVHVGDSAAQTQLK", "site_lbl": "Asn239", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVnCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "INNGGCQDLCLLTHQGHVNCSCR", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "2502", "site_seq": "N", "site_lbl": "Asn2502", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 2502, "end_pos": 2502, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "239", "site_seq": "", "site_lbl": "N239", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "12", "chr_pos": "57145365", "evidence": [ { "id": "rs772978789", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772978789" }, { "id": "rs772978789", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772978789" }, { "id": "rs772978789", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772978789#frequency_tab" }, { "id": "rs772978789", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772978789" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 239, "end_pos": 239, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "8", "chr_pos": "18059633", "evidence": [ { "id": "rs1799610079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799610079" }, { "id": "rs1799610079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799610079" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "8", "chr_pos": "18059632", "evidence": [ { "id": "rs371154344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371154344#frequency_tab" }, { "id": "rs371154344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371154344" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "8", "chr_pos": "18059633", "evidence": [ { "id": "rs1799610079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799610079" }, { "id": "rs1799610079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799610079" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "8", "chr_pos": "18059632", "evidence": [ { "id": "rs371154344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371154344#frequency_tab" }, { "id": "rs371154344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371154344" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on ceramide catabolic process.", "evidence": [ { "database": "UniProtKB", "id": "Q13510", "url": "https://www.uniprot.org/uniprotkb/Q13510" }, { "database": "PubMed", "id": "11451951", "url": "https://glygen.org/publication/PubMed/11451951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "348", "site_seq": "YTGTRPSNLAnNTILVK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "YTGTRPSNLAnNTILVK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "YTGTRPSNLAnNTILVK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "YTGTRPSNLAnNTILVK", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "233767893", "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1575830712#frequency_tab" }, { "id": "rs1575830712", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1575830712" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35503-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 60338.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "5", "chr_pos": "177337491", "evidence": [ { "id": "rs1257503300", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257503300" }, { "id": "rs1257503300", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257503300#frequency_tab" }, { "id": "rs1257503300", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257503300" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "5", "chr_pos": "177337491", "evidence": [ { "id": "rs1257503300", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257503300" }, { "id": "rs1257503300", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257503300#frequency_tab" }, { "id": "rs1257503300", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257503300" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "1901", "site_seq": "VSQAESHAAQLnDSSAVLDGILDEAK", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "VSQAESHAAQLNDSSAVLDGILDEAK", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "N", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "VSQAESHAAQLnDSSAVLDGILDEAK", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "VSQAESHAAQLNDSSAVLDGILDEAK", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "N", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "VSQAESHAAQLnDSSAVLDGILDEAK", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "VSQAESHAAQLNDSSAVLDGILDEAK", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "N", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "", "site_lbl": "N1901", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "6", "chr_pos": "129402463", "evidence": [ { "id": "rs1583666878", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1583666878" }, { "id": "rs1583666878", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1583666878" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->YDS).", "chr_id": "NC_000006.12", "chr_pos": "129402462", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "VSQAESHAAQLnDSSAVLDGILDEAK", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "VSQAESHAAQLNDSSAVLDGILDEAK", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "N", "site_lbl": "Asn1901", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "1901", "site_seq": "", "site_lbl": "N1901", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "6", "chr_pos": "129402463", "evidence": [ { "id": "rs1583666878", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1583666878" }, { "id": "rs1583666878", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1583666878" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->YDS).", "chr_id": "NC_000006.12", "chr_pos": "129402462", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24043-1", "start_pos": 1901, "end_pos": 1901, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3122, "chemical_mass": 343905.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "N", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSKDEPGEQVELK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "nATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "NATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLnASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "N", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSKDEPGEQVELK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "nATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "NATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLnASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "N", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSKDEPGEQVELK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "nATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "NATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLnASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "", "site_lbl": "N596", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "119049575", "evidence": [ { "id": "Q9Y4L1", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y4L1" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "11", "chr_pos": "119049576", "evidence": [ { "id": "rs2133574126", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133574126" }, { "id": "rs2133574126", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133574126" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "", "site_lbl": "N931", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "11", "chr_pos": "119046605", "evidence": [ { "id": "rs1317070841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1317070841" }, { "id": "rs1317070841", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1317070841#frequency_tab" }, { "id": "rs2133551387", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551387" }, { "id": "rs2133551387", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551387" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "11", "chr_pos": "119046606", "evidence": [ { "id": "rs782171221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782171221" }, { "id": "rs782171221", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782171221#frequency_tab" }, { "id": "rs782171221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782171221" }, { "id": "rs2133551439", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551439" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "N", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "EnGTDTVQEEEESPAEGSKDEPGEQVELK", "site_lbl": "Asn596", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "nATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "NATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLnASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "596", "site_seq": "", "site_lbl": "N596", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "119049575", "evidence": [ { "id": "Q9Y4L1", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9Y4L1" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "11", "chr_pos": "119049576", "evidence": [ { "id": "rs2133574126", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133574126" }, { "id": "rs2133574126", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133574126" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 596, "end_pos": 596, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "", "site_lbl": "N931", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "11", "chr_pos": "119046605", "evidence": [ { "id": "rs1317070841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1317070841" }, { "id": "rs1317070841", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1317070841#frequency_tab" }, { "id": "rs2133551387", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551387" }, { "id": "rs2133551387", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551387" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "11", "chr_pos": "119046606", "evidence": [ { "id": "rs782171221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782171221" }, { "id": "rs782171221", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782171221#frequency_tab" }, { "id": "rs782171221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782171221" }, { "id": "rs2133551439", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551439" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSAnLTDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSANLTDKELEAFREELK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSAnLTDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSANLTDKELEAFREELK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSAnLTDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSANLTDKELEAFREELK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "", "site_lbl": "N268", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSAnLTDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "VIDLWDLAQSANLTDKELEAFREELK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "268", "site_seq": "", "site_lbl": "N268", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "4", "chr_pos": "3516147", "evidence": [ { "id": "rs754280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754280813" }, { "id": "rs754280813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754280813#frequency_tab" }, { "id": "rs754280813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754280813" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P30533-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin receptor-associated protein", "gene_name": "LRPAP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 357, "chemical_mass": 41466.0 } ] }, { "start_pos": "348", "site_seq": "LVAnESVPFETSCR", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "LVANESVPFETSCR", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "LVAnESVPFETSCR", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "LVANESVPFETSCR", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "LVAnESVPFETSCR", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "LVANESVPFETSCR", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->DES).", "chr_id": "3", "chr_pos": "49005015", "evidence": [ { "id": "rs200494971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200494971" }, { "id": "rs200494971", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200494971" }, { "id": "rs200494971", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200494971" }, { "id": "rs200494971", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200494971#frequency_tab" }, { "id": "rs200494971", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200494971" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "LVAnESVPFETSCR", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "LVANESVPFETSCR", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "N", "site_lbl": "Asn348", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "348", "site_seq": "", "site_lbl": "N348", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->DES).", "chr_id": "3", "chr_pos": "49005015", "evidence": [ { "id": "rs200494971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200494971" }, { "id": "rs200494971", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200494971" }, { "id": "rs200494971", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200494971" }, { "id": "rs200494971", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200494971#frequency_tab" }, { "id": "rs200494971", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200494971" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NXG6-1", "start_pos": 348, "end_pos": 348, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane prolyl 4-hydroxylase", "gene_name": "P4HTM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 502, "chemical_mass": 56661.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "11", "chr_pos": "32091354", "evidence": [ { "id": "rs764801279", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764801279" }, { "id": "rs764801279", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs764801279" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "11", "chr_pos": "32091354", "evidence": [ { "id": "rs764801279", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764801279" }, { "id": "rs764801279", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs764801279" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "1035", "site_seq": "DVDECALGTHnCSEAETCHNIQGSFR", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "N", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "DVDECALGTHNCSEAETCHNIQGSFR", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "DVDECALGTHnCSEAETCHNIQGSFR", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "N", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "DVDECALGTHNCSEAETCHNIQGSFR", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "DVDECALGTHnCSEAETCHNIQGSFR", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "N", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "DVDECALGTHNCSEAETCHNIQGSFR", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "", "site_lbl": "N1035", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "3", "chr_pos": "13636475", "evidence": [ { "id": "rs1706475038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1706475038" }, { "id": "rs1706475038", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1706475038" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->YCS).", "chr_id": "3", "chr_pos": "13636474", "evidence": [ { "id": "rs1264877212", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1264877212" }, { "id": "rs1264877212", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1264877212#frequency_tab" }, { "id": "rs1264877212", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1264877212" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "DVDECALGTHnCSEAETCHNIQGSFR", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "N", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "DVDECALGTHNCSEAETCHNIQGSFR", "site_lbl": "Asn1035", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "1035", "site_seq": "", "site_lbl": "N1035", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "3", "chr_pos": "13636475", "evidence": [ { "id": "rs1706475038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1706475038" }, { "id": "rs1706475038", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1706475038" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->YCS).", "chr_id": "3", "chr_pos": "13636474", "evidence": [ { "id": "rs1264877212", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1264877212" }, { "id": "rs1264877212", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1264877212#frequency_tab" }, { "id": "rs1264877212", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1264877212" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98095-1", "start_pos": 1035, "end_pos": 1035, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-2", "gene_name": "FBLN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1184, "chemical_mass": 126573.0 } ] }, { "start_pos": "249", "site_seq": "NDRnSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "nSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NDRnSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "nSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NDRnSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "nSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "7", "chr_pos": "23260501", "evidence": [ { "id": "rs769718537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769718537" }, { "id": "rs769718537", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769718537" }, { "id": "rs769718537", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769718537#frequency_tab" }, { "id": "rs769718537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769718537" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NDRnSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "nSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "NSSDETFLK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "7", "chr_pos": "23260501", "evidence": [ { "id": "rs769718537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769718537" }, { "id": "rs769718537", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769718537" }, { "id": "rs769718537", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769718537#frequency_tab" }, { "id": "rs769718537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769718537" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "LDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "N", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "107", "site_seq": "AKLDAFFALEGFPTEPnSSSR", "site_lbl": "Asn107", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08294-1", "start_pos": 107, "end_pos": 107, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 240, "chemical_mass": 25851.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "", "site_lbl": "N430", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT); n-glyco-sequon-gain (NHN->NHS).", "chr_id": "2", "chr_pos": "215423454", "evidence": [ { "id": "rs747033490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747033490#frequency_tab" }, { "id": "rs747033490", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747033490" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "", "site_lbl": "N1007", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "215404622", "evidence": [ { "id": "rs145838840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145838840#frequency_tab" }, { "id": "rs145838840", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145838840" } ], "disease": [ { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "215404623", "evidence": [ { "id": "rs768650910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768650910" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "2", "chr_pos": "215420764", "evidence": [ { "id": "rs528350304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528350304#frequency_tab" }, { "id": "rs528350304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528350304" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "", "site_lbl": "N542", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "2", "chr_pos": "215420724", "evidence": [ { "id": "rs749189506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749189506" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "2", "chr_pos": "215420722", "evidence": [ { "id": "rs138144264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138144264" }, { "id": "rs138144264", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138144264#frequency_tab" }, { "id": "rs138144264", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138144264" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "2", "chr_pos": "215420723", "evidence": [ { "id": "rs576328100", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576328100" }, { "id": "rs576328100", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576328100" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "", "site_lbl": "N430", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT); n-glyco-sequon-gain (NHN->NHS).", "chr_id": "2", "chr_pos": "215423454", "evidence": [ { "id": "rs747033490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747033490#frequency_tab" }, { "id": "rs747033490", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747033490" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "", "site_lbl": "N1007", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "215404622", "evidence": [ { "id": "rs145838840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145838840#frequency_tab" }, { "id": "rs145838840", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145838840" } ], "disease": [ { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "215404623", "evidence": [ { "id": "rs768650910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768650910" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "2", "chr_pos": "215420764", "evidence": [ { "id": "rs528350304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528350304#frequency_tab" }, { "id": "rs528350304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528350304" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "", "site_lbl": "N542", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "2", "chr_pos": "215420724", "evidence": [ { "id": "rs749189506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749189506" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "2", "chr_pos": "215420722", "evidence": [ { "id": "rs138144264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138144264" }, { "id": "rs138144264", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138144264#frequency_tab" }, { "id": "rs138144264", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138144264" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "2", "chr_pos": "215420723", "evidence": [ { "id": "rs576328100", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576328100" }, { "id": "rs576328100", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576328100" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYnSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "N", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYNSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYnSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "N", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYNSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYnSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "N", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYNSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "", "site_lbl": "N82", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "19", "chr_pos": "41352801", "evidence": [ { "id": "rs1411294450", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411294450" }, { "id": "rs1411294450", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411294450#frequency_tab" }, { "id": "rs1411294450", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411294450" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "19", "chr_pos": "41352801", "evidence": [ { "id": "rs1411294450", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411294450" }, { "id": "rs1411294450", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411294450#frequency_tab" }, { "id": "rs1411294450", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411294450" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYnSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "N", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "LASPPSQGEVPPGPLPEAVLALYNSTR", "site_lbl": "Asn82", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "82", "site_seq": "", "site_lbl": "N82", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "19", "chr_pos": "41352801", "evidence": [ { "id": "rs1411294450", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411294450" }, { "id": "rs1411294450", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411294450#frequency_tab" }, { "id": "rs1411294450", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411294450" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "19", "chr_pos": "41352801", "evidence": [ { "id": "rs1411294450", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411294450" }, { "id": "rs1411294450", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411294450#frequency_tab" }, { "id": "rs1411294450", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411294450" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01137-1", "start_pos": 82, "end_pos": 82, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 390, "chemical_mass": 44325.0 } ] }, { "start_pos": "977", "site_seq": "IDCYPDENGASAEnCTAR", "site_lbl": "Asn977", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "N", "site_lbl": "Asn977", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "IDCYPDENGASAEnCTAR", "site_lbl": "Asn977", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "N", "site_lbl": "Asn977", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "IDCYPDENGASAEnCTAR", "site_lbl": "Asn977", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "N", "site_lbl": "Asn977", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "", "site_lbl": "N977", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 0 out of 0 filters:", "chr_id": "NC_000007.14", "chr_pos": "142052417", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "IDCYPDENGASAEnCTAR", "site_lbl": "Asn977", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "N", "site_lbl": "Asn977", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "977", "site_seq": "", "site_lbl": "N977", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 0 out of 0 filters:", "chr_id": "NC_000007.14", "chr_pos": "142052417", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 977, "end_pos": 977, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "536", "site_seq": "DDPYSGHQFSFSLAPEAASGSnFTIQDNK", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "N", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "DDPYSGHQFSFSLAPEAASGSnFTIQDNK", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "N", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "DDPYSGHQFSFSLAPEAASGSnFTIQDNK", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "N", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "", "site_lbl": "N536", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "5", "chr_pos": "31317469", "evidence": [ { "id": "rs1738356471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1738356471" }, { "id": "rs1738356471", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1738356471#frequency_tab" }, { "id": "rs1738356471", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1738356471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "DDPYSGHQFSFSLAPEAASGSnFTIQDNK", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "N", "site_lbl": "Asn536", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "536", "site_seq": "", "site_lbl": "N536", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "5", "chr_pos": "31317469", "evidence": [ { "id": "rs1738356471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1738356471" }, { "id": "rs1738356471", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1738356471#frequency_tab" }, { "id": "rs1738356471", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1738356471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 536, "end_pos": 536, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDnTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "N", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDNTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "NDVVQHYWDVLVQAFVQnGTVSTNEFLCDK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "NDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "N", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "YETTnK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "YETTNKTYK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDnTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "N", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDNTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "NDVVQHYWDVLVQAFVQnGTVSTNEFLCDK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "NDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "N", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "YETTnK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "YETTNKTYK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDnTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "N", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDNTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "NDVVQHYWDVLVQAFVQnGTVSTNEFLCDK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "NDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "N", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "YETTnK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "YETTNKTYK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "", "site_lbl": "N123", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->YTT).", "chr_id": "X", "chr_pos": "120455387", "evidence": [ { "id": "rs1921042232", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1921042232" }, { "id": "rs1921042232", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1921042232#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "", "site_lbl": "N179", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "23", "chr_pos": "120448991", "evidence": [ { "id": "P13473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P13473" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "", "site_lbl": "N58", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "X", "chr_pos": "120456661", "evidence": [ { "id": "rs1294027053", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1294027053" }, { "id": "rs1294027053", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1294027053#frequency_tab" }, { "id": "rs1294027053", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1294027053" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDnTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "N", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "AASTYSIDSVSFSYNTGDNTTFPDAEDK", "site_lbl": "Asn123", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "NDVVQHYWDVLVQAFVQnGTVSTNEFLCDK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "NDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDK", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "N", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "YETTnK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "N", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "YETTNKTYK", "site_lbl": "Asn58", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "123", "site_seq": "", "site_lbl": "N123", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->YTT).", "chr_id": "X", "chr_pos": "120455387", "evidence": [ { "id": "rs1921042232", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1921042232" }, { "id": "rs1921042232", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1921042232#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 123, "end_pos": 123, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "179", "site_seq": "", "site_lbl": "N179", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "23", "chr_pos": "120448991", "evidence": [ { "id": "P13473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P13473" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "58", "site_seq": "", "site_lbl": "N58", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "X", "chr_pos": "120456661", "evidence": [ { "id": "rs1294027053", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1294027053" }, { "id": "rs1294027053", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1294027053#frequency_tab" }, { "id": "rs1294027053", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1294027053" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 58, "end_pos": 58, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "314", "site_seq": "DQnATNNGCAMASR", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJW2-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen", "gene_name": "TINAG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54605.0 } ] }, { "start_pos": "314", "site_seq": "N", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJW2-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen", "gene_name": "TINAG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54605.0 } ] }, { "start_pos": "314", "site_seq": "DQnATNNGCAMASR", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJW2-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen", "gene_name": "TINAG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54605.0 } ] }, { "start_pos": "314", "site_seq": "N", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJW2-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen", "gene_name": "TINAG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54605.0 } ] }, { "start_pos": "314", "site_seq": "DQnATNNGCAMASR", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJW2-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen", "gene_name": "TINAG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54605.0 } ] }, { "start_pos": "314", "site_seq": "N", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJW2-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen", "gene_name": "TINAG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54605.0 } ] }, { "start_pos": "314", "site_seq": "DQnATNNGCAMASR", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJW2-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen", "gene_name": "TINAG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54605.0 } ] }, { "start_pos": "314", "site_seq": "N", "site_lbl": "Asn314", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UJW2-1", "start_pos": 314, "end_pos": 314, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen", "gene_name": "TINAG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 476, "chemical_mass": 54605.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "336", "site_seq": "LHVGNYnGTAGDALR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "N", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "LHVGNYnGTAGDALR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "N", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "LHVGNYnGTAGDALR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "N", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "LHVGNYnGTAGDALR", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "336", "site_seq": "N", "site_lbl": "Asn336", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14314-1", "start_pos": 336, "end_pos": 336, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibroleukin", "gene_name": "FGL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 439, "chemical_mass": 50229.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "EDALnETRESETK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "KEDALnETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "EDALnETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "KKEDALNETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "EDALnETRESETK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "KEDALnETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "EDALnETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "KKEDALNETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "EDALnETRESETK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "KEDALnETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "EDALnETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "KKEDALNETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "N374", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "NC_000008.11", "chr_pos": "27599822", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "", "site_lbl": "N86", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "8", "chr_pos": "27606515", "evidence": [ { "id": "rs1313161587", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1313161587" }, { "id": "rs1313161587", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1313161587" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "N", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "EDALnETRESETK", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "KEDALnETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "EDALnETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "KKEDALNETR", "site_lbl": "Asn86", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "N374", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "NC_000008.11", "chr_pos": "27599822", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "", "site_lbl": "N86", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "8", "chr_pos": "27606515", "evidence": [ { "id": "rs1313161587", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1313161587" }, { "id": "rs1313161587", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1313161587" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-354. Decreases secretion; when associated with Q-291 and Q-354.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "86", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of beta chain; when associated with Q-103 and Q-145.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 86, "end_pos": 86, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "548", "site_seq": "EQYIHEnYSR", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "EQYIHENYSR", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "N", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "EQYIHEnYSR", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "EQYIHENYSR", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "N", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "EQYIHEnYSR", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "EQYIHENYSR", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "N", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "", "site_lbl": "N548", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "7", "chr_pos": "101210132", "evidence": [ { "id": "rs1798158118", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1798158118" }, { "id": "rs1798158118", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1798158118#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "EQYIHEnYSR", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "EQYIHENYSR", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "N", "site_lbl": "Asn548", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "548", "site_seq": "", "site_lbl": "N548", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "7", "chr_pos": "101210132", "evidence": [ { "id": "rs1798158118", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1798158118" }, { "id": "rs1798158118", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1798158118#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60568-1", "start_pos": 548, "end_pos": 548, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3", "gene_name": "PLOD3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 84785.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "", "site_lbl": "N57", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "16", "chr_pos": "89635973", "evidence": [ { "id": "rs2059672792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2059672792" }, { "id": "rs2059672792", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2059672792" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "AnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "LQDERAnLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "ANLTTLAGTHTNIPK", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "N", "site_lbl": "Asn57", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "57", "site_seq": "", "site_lbl": "N57", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "16", "chr_pos": "89635973", "evidence": [ { "id": "rs2059672792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2059672792" }, { "id": "rs2059672792", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2059672792" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 57, "end_pos": 57, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "MIEnGSLSFLPTLR", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "N", "site_lbl": "Asn270", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "270", "site_seq": "", "site_lbl": "N270", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "X", "chr_pos": "153507084", "evidence": [ { "id": "rs782180400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782180400" }, { "id": "rs782180400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782180400" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 270, "end_pos": 270, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "150", "site_seq": "CCGAAnYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAANYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAAnYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAANYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAAnYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAANYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "", "site_lbl": "N150", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->DYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "rs1167328183", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167328183" }, { "id": "rs1167328183", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1167328183#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->HYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "P08962", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08962" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->TYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAAnYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "N", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "CCGAANYTDWEK", "site_lbl": "Asn150", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "150", "site_seq": "", "site_lbl": "N150", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->DYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "rs1167328183", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167328183" }, { "id": "rs1167328183", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1167328183#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->HYT).", "chr_id": "12", "chr_pos": "55726240", "evidence": [ { "id": "P08962", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08962" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->TYT).", "chr_id": "12", "chr_pos": "55726239", "evidence": [ { "id": "rs1367384879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367384879" }, { "id": "rs1367384879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367384879" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08962-1", "start_pos": 150, "end_pos": 150, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD63 antigen", "gene_name": "CD63", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 238, "chemical_mass": 25637.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLnSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLNSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "N", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLnSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLNSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "N", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLnSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLNSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "N", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "", "site_lbl": "N324", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "4", "chr_pos": "110506688", "evidence": [ { "id": "rs1357172069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357172069" }, { "id": "rs1357172069", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357172069" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "", "site_lbl": "N607", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "4", "chr_pos": "110542764", "evidence": [ { "id": "rs773384440", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773384440" }, { "id": "rs773384440", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773384440" }, { "id": "rs773384440", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773384440#frequency_tab" }, { "id": "rs773384440", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773384440" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLnSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "EGITLNSSNPSGNAFLK", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "N", "site_lbl": "Asn607", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "", "site_lbl": "N324", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "4", "chr_pos": "110506688", "evidence": [ { "id": "rs1357172069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357172069" }, { "id": "rs1357172069", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357172069" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "607", "site_seq": "", "site_lbl": "N607", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "4", "chr_pos": "110542764", "evidence": [ { "id": "rs773384440", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773384440" }, { "id": "rs773384440", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773384440" }, { "id": "rs773384440", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773384440#frequency_tab" }, { "id": "rs773384440", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773384440" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 607, "end_pos": 607, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "922", "site_seq": "GVVTDEQGIPIAnATISVSGINHGVK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "N", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "GVVTDEQGIPIAnATISVSGINHGVK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "N", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "GVVTDEQGIPIAnATISVSGINHGVK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "N", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "", "site_lbl": "N922", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "7", "chr_pos": "44113308", "evidence": [ { "id": "rs746396415", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746396415#frequency_tab" }, { "id": "rs746396415", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746396415" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "7", "chr_pos": "44113307", "evidence": [ { "id": "Q8IUX7", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8IUX7" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "GVVTDEQGIPIAnATISVSGINHGVK", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "N", "site_lbl": "Asn922", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "922", "site_seq": "", "site_lbl": "N922", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "7", "chr_pos": "44113308", "evidence": [ { "id": "rs746396415", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746396415" }, { "id": "rs746396415", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746396415#frequency_tab" }, { "id": "rs746396415", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746396415" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "7", "chr_pos": "44113307", "evidence": [ { "id": "Q8IUX7", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8IUX7" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IUX7-1", "start_pos": 922, "end_pos": 922, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adipocyte enhancer-binding protein 1", "gene_name": "AEBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1158, "chemical_mass": 130929.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGnCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGNCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "YLQPLLAVQFTnLTMDTEIR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "YLQPLLAVQFTNLTMDTEIR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGnCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGNCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "YLQPLLAVQFTnLTMDTEIR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "YLQPLLAVQFTNLTMDTEIR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGnCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGNCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "YLQPLLAVQFTnLTMDTEIR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "YLQPLLAVQFTNLTMDTEIR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "", "site_lbl": "N158", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "1", "chr_pos": "169127314", "evidence": [ { "id": "rs139587518", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139587518" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "", "site_lbl": "N265", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "1", "chr_pos": "169131437", "evidence": [ { "id": "P05026", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05026" }, { "id": "rs369488918", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369488918" }, { "id": "rs369488918", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs369488918" }, { "id": "rs369488918", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369488918" }, { "id": "rs369488918", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369488918#frequency_tab" }, { "id": "rs369488918", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369488918" }, { "id": "rs369488918", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs369488918" } ], "disease": [ { "disease_id": "DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix.", "url": "http://disease-ontology.org/term/DOID:4362", "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGnCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "N", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "LEWLGNCSGLNDETYGYK", "site_lbl": "Asn158", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "YLQPLLAVQFTnLTMDTEIR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "YLQPLLAVQFTNLTMDTEIR", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "N", "site_lbl": "Asn265", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "158", "site_seq": "", "site_lbl": "N158", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "1", "chr_pos": "169127314", "evidence": [ { "id": "rs139587518", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139587518" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 158, "end_pos": 158, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "265", "site_seq": "", "site_lbl": "N265", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "1", "chr_pos": "169131437", "evidence": [ { "id": "P05026", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05026" }, { "id": "rs369488918", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369488918" }, { "id": "rs369488918", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs369488918" }, { "id": "rs369488918", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369488918" }, { "id": "rs369488918", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369488918#frequency_tab" }, { "id": "rs369488918", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369488918" }, { "id": "rs369488918", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs369488918" } ], "disease": [ { "disease_id": "DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix.", "url": "http://disease-ontology.org/term/DOID:4362", "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05026-1", "start_pos": 265, "end_pos": 265, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 35061.0 } ] }, { "start_pos": "1706", "site_seq": "AASnFTEIK", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "AASNFTEIK", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "N", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "AASnFTEIK", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "AASNFTEIK", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "N", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "AASnFTEIK", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "AASNFTEIK", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "N", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "", "site_lbl": "N1706", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "11", "chr_pos": "121607240", "evidence": [ { "id": "Q92673", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92673" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "AASnFTEIK", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "AASNFTEIK", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "N", "site_lbl": "Asn1706", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1706", "site_seq": "", "site_lbl": "N1706", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "11", "chr_pos": "121607240", "evidence": [ { "id": "Q92673", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92673" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1706, "end_pos": 1706, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "818", "site_seq": "nATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "N", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "NATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "nATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "N", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "NATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "nATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "N", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "NATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "", "site_lbl": "N818", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "89792235", "evidence": [ { "id": "rs1968642413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1968642413" }, { "id": "rs1968642413", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1968642413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "nATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "N", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "NATLVNEADK", "site_lbl": "Asn818", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "", "site_lbl": "N818", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "89792235", "evidence": [ { "id": "rs1968642413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1968642413" }, { "id": "rs1968642413", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1968642413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "818", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "E", "comment": "Very low receptor activity and HCoV-229E infection.", "evidence": [ { "database": "UniProtKB", "id": "P15144", "url": "https://www.uniprot.org/uniprotkb/P15144" }, { "database": "PubMed", "id": "11559807", "url": "https://glygen.org/publication/PubMed/11559807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15144-1", "start_pos": 818, "end_pos": 818, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Aminopeptidase N", "gene_name": "ANPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 967, "chemical_mass": 109540.0 } ] }, { "start_pos": "275", "site_seq": "VLTLNLDQVDFQHAGnYSCVASNVQGK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "275", "site_seq": "VLTLNLDQVDFQHAGnYSCVASNVQGK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "275", "site_seq": "VLTLNLDQVDFQHAGnYSCVASNVQGK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "275", "site_seq": "", "site_lbl": "N275", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->HYS).", "chr_id": "5", "chr_pos": "150077342", "evidence": [ { "id": "rs2113824315", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2113824315" }, { "id": "rs2113824315", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2113824315" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "5", "chr_pos": "150077341", "evidence": [ { "id": "rs2113824309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2113824309" }, { "id": "rs2113824309", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2113824309" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->KYS).", "chr_id": "5", "chr_pos": "150077340", "evidence": [ { "id": "rs1758310511", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1758310511" }, { "id": "rs1758310511", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1758310511#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "5", "chr_pos": "150077341", "evidence": [ { "id": "P07333", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07333" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->TYS).", "chr_id": "5", "chr_pos": "150077341", "evidence": [ { "id": "rs2113824309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2113824309" }, { "id": "rs2113824309", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2113824309" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->YYS).", "chr_id": "5", "chr_pos": "150077342", "evidence": [ { "id": "rs2113824315", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2113824315" }, { "id": "rs2113824315", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2113824315" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "275", "site_seq": "VLTLNLDQVDFQHAGnYSCVASNVQGK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "275", "site_seq": "", "site_lbl": "N275", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->HYS).", "chr_id": "5", "chr_pos": "150077342", "evidence": [ { "id": "rs2113824315", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2113824315" }, { "id": "rs2113824315", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2113824315" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "5", "chr_pos": "150077341", "evidence": [ { "id": "rs2113824309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2113824309" }, { "id": "rs2113824309", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2113824309" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->KYS).", "chr_id": "5", "chr_pos": "150077340", "evidence": [ { "id": "rs1758310511", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1758310511" }, { "id": "rs1758310511", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1758310511#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "5", "chr_pos": "150077341", "evidence": [ { "id": "P07333", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07333" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->TYS).", "chr_id": "5", "chr_pos": "150077341", "evidence": [ { "id": "rs2113824309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2113824309" }, { "id": "rs2113824309", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2113824309" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->YYS).", "chr_id": "5", "chr_pos": "150077342", "evidence": [ { "id": "rs2113824315", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2113824315" }, { "id": "rs2113824315", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2113824315" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07333-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 972, "chemical_mass": 107984.0 } ] }, { "start_pos": "954", "site_seq": "HAELSFVFLTDGVTGnDSLHESAHSMR", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "N", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "RHAELSFVFLTDGVTGNDSLHESAHSMR", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "HAELSFVFLTDGVTGnDSLHESAHSMR", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "N", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "RHAELSFVFLTDGVTGNDSLHESAHSMR", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "HAELSFVFLTDGVTGnDSLHESAHSMR", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "N", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "RHAELSFVFLTDGVTGNDSLHESAHSMR", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "", "site_lbl": "N954", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "21", "chr_pos": "46132354", "evidence": [ { "id": "rs761975390", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761975390" }, { "id": "rs761975390", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761975390" }, { "id": "rs761975390", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761975390#frequency_tab" }, { "id": "rs761975390", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761975390" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "21", "chr_pos": "46132353", "evidence": [ { "id": "rs1172651127", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172651127" }, { "id": "rs1172651127", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172651127" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "HAELSFVFLTDGVTGnDSLHESAHSMR", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "N", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "RHAELSFVFLTDGVTGNDSLHESAHSMR", "site_lbl": "Asn954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "954", "site_seq": "", "site_lbl": "N954", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "21", "chr_pos": "46132354", "evidence": [ { "id": "rs761975390", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761975390" }, { "id": "rs761975390", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761975390" }, { "id": "rs761975390", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761975390#frequency_tab" }, { "id": "rs761975390", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761975390" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "21", "chr_pos": "46132353", "evidence": [ { "id": "rs1172651127", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172651127" }, { "id": "rs1172651127", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172651127" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 954, "end_pos": 954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "", "site_lbl": "N205", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" }, { "id": "rs768936464", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768936464" }, { "id": "rs768936464", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs768936464" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "N", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "294", "site_seq": "LNAENnATFYFK", "site_lbl": "Asn294", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 294, "end_pos": 294, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "", "site_lbl": "N205", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" }, { "id": "rs768936464", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768936464" }, { "id": "rs768936464", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs768936464" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "268", "site_seq": "WGQnCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQNCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQnCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQNCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQnCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQNCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQnCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "WGQNCSCHHGGYYNCEDK", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "268", "site_seq": "N", "site_lbl": "Asn268", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04066-1", "start_pos": 268, "end_pos": 268, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tissue alpha-L-fucosidase", "gene_name": "FUCA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 466, "chemical_mass": 53689.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQRADDK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDNTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQRADDK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDNTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQRADDK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDNTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "", "site_lbl": "N138", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "3", "chr_pos": "149210360", "evidence": [ { "id": "rs757785679", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757785679" }, { "id": "rs757785679", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757785679" }, { "id": "rs757785679", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757785679#frequency_tab" }, { "id": "rs757785679", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757785679" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "", "site_lbl": "N762", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "3", "chr_pos": "149183605", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" }, { "id": "rs1576737229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1576737229" }, { "id": "rs1576737229", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1576737229" } ], "disease": [ { "disease_id": "DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage.", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->TVS).", "chr_id": "3", "chr_pos": "149185239", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "N", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDnTTDFQRADDK", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "EHEGAIYPDNTTDFQR", "site_lbl": "Asn138", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "N", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQnVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "ELHHLQEQNVSNAFLDK", "site_lbl": "Asn762", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "138", "site_seq": "", "site_lbl": "N138", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "3", "chr_pos": "149210360", "evidence": [ { "id": "rs757785679", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757785679" }, { "id": "rs757785679", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757785679" }, { "id": "rs757785679", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757785679#frequency_tab" }, { "id": "rs757785679", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757785679" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 138, "end_pos": 138, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "762", "site_seq": "", "site_lbl": "N762", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "3", "chr_pos": "149183605", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" }, { "id": "rs1576737229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1576737229" }, { "id": "rs1576737229", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1576737229" } ], "disease": [ { "disease_id": "DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage.", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->TVS).", "chr_id": "3", "chr_pos": "149185239", "evidence": [ { "id": "P00450", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P00450" } ], "disease": [ { "disease_id": "DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland.", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 762, "end_pos": 762, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "", "site_lbl": "N367", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "15475571", "evidence": [ { "id": "rs758375344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758375344#frequency_tab" }, { "id": "rs758375344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758375344" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "19", "chr_pos": "15475570", "evidence": [ { "id": "rs752659784", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752659784#frequency_tab" }, { "id": "rs752659784", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752659784" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "", "site_lbl": "N367", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "15475571", "evidence": [ { "id": "rs758375344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758375344#frequency_tab" }, { "id": "rs758375344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758375344" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "19", "chr_pos": "15475570", "evidence": [ { "id": "rs752659784", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752659784#frequency_tab" }, { "id": "rs752659784", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752659784" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "", "site_lbl": "N84", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->TTS).", "chr_id": "13", "chr_pos": "113309710", "evidence": [ { "id": "rs762446154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762446154#frequency_tab" }, { "id": "rs762446154", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762446154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "", "site_lbl": "N84", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->TTS).", "chr_id": "13", "chr_pos": "113309710", "evidence": [ { "id": "rs762446154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762446154#frequency_tab" }, { "id": "rs762446154", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762446154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "1716", "site_seq": "GnHSITQFTQADIDDMK", "site_lbl": "Asn1716", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 1716, "end_pos": 1716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "1716", "site_seq": "GNHSITQFTQADIDDMK", "site_lbl": "Asn1716", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 1716, "end_pos": 1716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "1716", "site_seq": "GnHSITQFTQADIDDMK", "site_lbl": "Asn1716", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 1716, "end_pos": 1716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "1716", "site_seq": "GNHSITQFTQADIDDMK", "site_lbl": "Asn1716", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 1716, "end_pos": 1716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "1716", "site_seq": "GnHSITQFTQADIDDMK", "site_lbl": "Asn1716", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 1716, "end_pos": 1716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "1716", "site_seq": "GNHSITQFTQADIDDMK", "site_lbl": "Asn1716", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 1716, "end_pos": 1716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "1716", "site_seq": "", "site_lbl": "N1716", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->KHS).", "chr_id": "13", "chr_pos": "38692492", "evidence": [ { "id": "rs2138073287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2138073287" }, { "id": "rs2138073287", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2138073287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 1716, "end_pos": 1716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "1716", "site_seq": "GnHSITQFTQADIDDMK", "site_lbl": "Asn1716", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 1716, "end_pos": 1716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "1716", "site_seq": "GNHSITQFTQADIDDMK", "site_lbl": "Asn1716", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 1716, "end_pos": 1716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "1716", "site_seq": "", "site_lbl": "N1716", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->KHS).", "chr_id": "13", "chr_pos": "38692492", "evidence": [ { "id": "rs2138073287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2138073287" }, { "id": "rs2138073287", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2138073287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q5SZK8-1", "start_pos": 1716, "end_pos": 1716, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "FRAS1-related extracellular matrix protein 2", "gene_name": "FREM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3169, "chemical_mass": 351167.0 } ] }, { "start_pos": "133", "site_seq": "ASSSFQAnGTK", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "ASSSFQAnGTK", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "ASSSFQAnGTK", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "", "site_lbl": "N133", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "19", "chr_pos": "50361733", "evidence": [ { "id": "rs1214907251", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1214907251" }, { "id": "rs1214907251", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1214907251#frequency_tab" }, { "id": "rs1214907251", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1214907251" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "ASSSFQAnGTK", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "N", "site_lbl": "Asn133", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "133", "site_seq": "", "site_lbl": "N133", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "19", "chr_pos": "50361733", "evidence": [ { "id": "rs1214907251", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1214907251" }, { "id": "rs1214907251", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1214907251#frequency_tab" }, { "id": "rs1214907251", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1214907251" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O96009-1", "start_pos": 133, "end_pos": 133, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Napsin-A", "gene_name": "NAPSA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 420, "chemical_mass": 45387.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "303", "site_seq": "YIQVVYLHNNnISVVGSSDFCPPGHNTK", "site_lbl": "Asn303", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 303, "end_pos": 303, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "303", "site_seq": "N", "site_lbl": "Asn303", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 303, "end_pos": 303, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "303", "site_seq": "YIQVVYLHNNnISVVGSSDFCPPGHNTK", "site_lbl": "Asn303", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 303, "end_pos": 303, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "303", "site_seq": "N", "site_lbl": "Asn303", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 303, "end_pos": 303, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "303", "site_seq": "YIQVVYLHNNnISVVGSSDFCPPGHNTK", "site_lbl": "Asn303", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 303, "end_pos": 303, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "303", "site_seq": "N", "site_lbl": "Asn303", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 303, "end_pos": 303, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "12", "chr_pos": "91157095", "evidence": [ { "id": "rs758510607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758510607" } ], "disease": [ { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "", "site_lbl": "N262", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "12", "chr_pos": "91151755", "evidence": [ { "id": "rs1881444182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1881444182" }, { "id": "rs1881444182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1881444182#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNKISR", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTnITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "IADTNITSIPQGLPPSLTELHLDGNK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDnGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "LGLSFNSISAVDNGSLANTPHLR", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "303", "site_seq": "YIQVVYLHNNnISVVGSSDFCPPGHNTK", "site_lbl": "Asn303", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 303, "end_pos": 303, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "303", "site_seq": "N", "site_lbl": "Asn303", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 303, "end_pos": 303, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "12", "chr_pos": "91157095", "evidence": [ { "id": "rs758510607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758510607" }, { "id": "rs758510607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758510607" } ], "disease": [ { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth.", "url": "http://disease-ontology.org/term/DOID:0060445", "evidence": [ { "id": "610048", "database": "MIM", "url": "https://www.omim.org/entry/610048" }, { "id": "0060445", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "262", "site_seq": "", "site_lbl": "N262", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "12", "chr_pos": "91151755", "evidence": [ { "id": "rs1881444182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1881444182" }, { "id": "rs1881444182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1881444182#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07585-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 359, "chemical_mass": 39747.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVNLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVNLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVNLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVNLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYnVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYNVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYnVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYNVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYnVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYNVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "", "site_lbl": "N122", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->YVS).", "chr_id": "6", "chr_pos": "31947072", "evidence": [ { "id": "rs1297491982", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1297491982" }, { "id": "rs1297491982", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1297491982" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYnVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "SPYYNVSDEISFHCYDGYTLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "122", "site_seq": "", "site_lbl": "N122", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->YVS).", "chr_id": "6", "chr_pos": "31947072", "evidence": [ { "id": "rs1297491982", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1297491982" }, { "id": "rs1297491982", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1297491982" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "", "site_lbl": "N282", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "ITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "LGLGNNKITDIEnGSLANIPR", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "N", "site_lbl": "Asn282", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "282", "site_seq": "", "site_lbl": "N282", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "9", "chr_pos": "92459732", "evidence": [ { "id": "rs1564332237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1564332237" }, { "id": "rs1564332237", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1564332237" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXN1-1", "start_pos": 282, "end_pos": 282, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Asporin", "gene_name": "ASPN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 43417.0 } ] }, { "start_pos": "119", "site_seq": "DLEITnATLQSEEDSR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "DLEITNATLQSEEDSR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "DLEITnATLQSEEDSR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "DLEITNATLQSEEDSR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "DLEITnATLQSEEDSR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "DLEITNATLQSEEDSR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "DLEITnATLQSEEDSR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "119", "site_seq": "DLEITNATLQSEEDSR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6P179-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmic reticulum aminopeptidase 2", "gene_name": "ERAP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 960, "chemical_mass": 110462.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "", "site_lbl": "N115", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "9", "chr_pos": "114074146", "evidence": [ { "id": "rs142267376", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142267376#frequency_tab" }, { "id": "rs142267376", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142267376" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "9", "chr_pos": "114074145", "evidence": [ { "id": "rs780025188", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780025188" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "9", "chr_pos": "114074147", "evidence": [ { "id": "rs1405775116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1405775116" }, { "id": "rs1405775116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1405775116" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "", "site_lbl": "N115", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "9", "chr_pos": "114074146", "evidence": [ { "id": "rs142267376", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142267376#frequency_tab" }, { "id": "rs142267376", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142267376" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "9", "chr_pos": "114074145", "evidence": [ { "id": "rs780025188", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780025188" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "9", "chr_pos": "114074147", "evidence": [ { "id": "rs1405775116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1405775116" }, { "id": "rs1405775116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1405775116" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "666", "site_seq": "GQVYLQCGTPCnLTCR", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "WnCTDHVCDATCSTIGMAHYLTFDGLK", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "N", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "GQVYLQCGTPCnLTCR", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "WnCTDHVCDATCSTIGMAHYLTFDGLK", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "N", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "GQVYLQCGTPCnLTCR", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "WnCTDHVCDATCSTIGMAHYLTFDGLK", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "N", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "", "site_lbl": "N666", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "6052732", "evidence": [ { "id": "rs780709880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780709880" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "12", "chr_pos": "6052732", "evidence": [ { "id": "rs780709880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780709880" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "", "site_lbl": "N857", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "12", "chr_pos": "6034803", "evidence": [ { "id": "rs765163545", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765163545" }, { "id": "rs765163545", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765163545" }, { "id": "rs765163545", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765163545#frequency_tab" }, { "id": "rs765163545", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765163545" } ], "disease": [ { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "GQVYLQCGTPCnLTCR", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "WnCTDHVCDATCSTIGMAHYLTFDGLK", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "N", "site_lbl": "Asn857", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "666", "site_seq": "", "site_lbl": "N666", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "6052732", "evidence": [ { "id": "rs780709880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780709880" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "12", "chr_pos": "6052732", "evidence": [ { "id": "rs780709880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780709880" }, { "id": "rs780709880", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780709880" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "857", "site_seq": "", "site_lbl": "N857", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "12", "chr_pos": "6034803", "evidence": [ { "id": "rs765163545", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765163545" }, { "id": "rs765163545", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765163545" }, { "id": "rs765163545", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765163545#frequency_tab" }, { "id": "rs765163545", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765163545" } ], "disease": [ { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0060574", "name": "von Willebrand's disease 2", "description": "A von Willebrand's disease characterized by qualitative but not quantitative abnormalities of the VWF protein that has_material_basis_in mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060574", "evidence": [ { "id": "0060574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060574" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 857, "end_pos": 857, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGnDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGNDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGnDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGNDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGnDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGNDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "", "site_lbl": "N267", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "19", "chr_pos": "10284195", "evidence": [ { "id": "rs755625816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755625816" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGnDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "N", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "LNPTVTYGNDSFSAK", "site_lbl": "Asn267", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "267", "site_seq": "", "site_lbl": "N267", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->TDS).", "chr_id": "19", "chr_pos": "10284195", "evidence": [ { "id": "rs755625816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755625816" }, { "id": "rs755625816", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755625816" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 267, "end_pos": 267, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "692", "site_seq": "TPLVQEVHQnFSAWCSQVVR", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "N", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "TPLVQEVHQNFSAWCSQVVR", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "TPLVQEVHQnFSAWCSQVVR", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "N", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "TPLVQEVHQNFSAWCSQVVR", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "TPLVQEVHQnFSAWCSQVVR", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "N", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "TPLVQEVHQNFSAWCSQVVR", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "TPLVQEVHQnFSAWCSQVVR", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "N", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "692", "site_seq": "TPLVQEVHQNFSAWCSQVVR", "site_lbl": "Asn692", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00754-1", "start_pos": 692, "end_pos": 692, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal alpha-mannosidase", "gene_name": "MAN2B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1011, "chemical_mass": 113744.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "N", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNKDK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "N", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNKDK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "N", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNKDK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "", "site_lbl": "N94", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->IYT).", "chr_id": "8", "chr_pos": "120162501", "evidence": [ { "id": "rs1815713404", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1815713404" }, { "id": "rs1815713404", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1815713404#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "N", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "AIIQGLMPDQnYTVQIIAYNKDK", "site_lbl": "Asn94", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "94", "site_seq": "", "site_lbl": "N94", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->IYT).", "chr_id": "8", "chr_pos": "120162501", "evidence": [ { "id": "rs1815713404", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1815713404" }, { "id": "rs1815713404", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1815713404#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q05707-1", "start_pos": 94, "end_pos": 94, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-1(XIV) chain", "gene_name": "COL14A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1796, "chemical_mass": 193515.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "", "site_lbl": "N546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "X", "chr_pos": "15572229", "evidence": [ { "id": "rs761944150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761944150#frequency_tab" }, { "id": "rs761944150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761944150" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "X", "chr_pos": "15572228", "evidence": [ { "id": "rs756905974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs756905974" }, { "id": "rs756905974", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756905974" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "", "site_lbl": "N546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "X", "chr_pos": "15572229", "evidence": [ { "id": "rs761944150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761944150#frequency_tab" }, { "id": "rs761944150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761944150" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "X", "chr_pos": "15572228", "evidence": [ { "id": "rs756905974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs756905974" }, { "id": "rs756905974", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756905974" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "198", "site_seq": "QVCDQGWTMnNSR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JB6-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 4", "gene_name": "LOXL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 84483.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JB6-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 4", "gene_name": "LOXL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 84483.0 } ] }, { "start_pos": "198", "site_seq": "QVCDQGWTMnNSR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JB6-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 4", "gene_name": "LOXL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 84483.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JB6-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 4", "gene_name": "LOXL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 84483.0 } ] }, { "start_pos": "198", "site_seq": "QVCDQGWTMnNSR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JB6-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 4", "gene_name": "LOXL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 84483.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JB6-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 4", "gene_name": "LOXL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 84483.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "N198", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNS->KNS).", "chr_id": "10", "chr_pos": "98260990", "evidence": [ { "id": "Q96JB6", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q96JB6" }, { "id": "rs773171846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773171846" }, { "id": "rs773171846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773171846" }, { "id": "rs773171846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773171846#frequency_tab" }, { "id": "rs773171846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773171846" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96JB6-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 4", "gene_name": "LOXL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 84483.0 } ] }, { "start_pos": "198", "site_seq": "QVCDQGWTMnNSR", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JB6-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 4", "gene_name": "LOXL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 84483.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96JB6-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 4", "gene_name": "LOXL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 84483.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "N198", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNS->KNS).", "chr_id": "10", "chr_pos": "98260990", "evidence": [ { "id": "Q96JB6", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q96JB6" }, { "id": "rs773171846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773171846" }, { "id": "rs773171846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773171846" }, { "id": "rs773171846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773171846#frequency_tab" }, { "id": "rs773171846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773171846" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96JB6-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 4", "gene_name": "LOXL4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 756, "chemical_mass": 84483.0 } ] }, { "start_pos": "966", "site_seq": "DINSQQELQnITTDTR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "N", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "DINSQQELQNITTDTR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "DINSQQELQnITTDTR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "N", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "DINSQQELQNITTDTR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "DINSQQELQnITTDTR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "N", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "DINSQQELQNITTDTR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "", "site_lbl": "N966", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "1", "chr_pos": "43604049", "evidence": [ { "id": "rs1654449880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1654449880" }, { "id": "rs1654449880", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1654449880" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "DINSQQELQnITTDTR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "N", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "DINSQQELQNITTDTR", "site_lbl": "Asn966", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "966", "site_seq": "", "site_lbl": "N966", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "1", "chr_pos": "43604049", "evidence": [ { "id": "rs1654449880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1654449880" }, { "id": "rs1654449880", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1654449880" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10586-1", "start_pos": 966, "end_pos": 966, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1907, "chemical_mass": 212879.0 } ] }, { "start_pos": "104", "site_seq": "nTTGEHCEK", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "nASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "N", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "NASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "nTTGEHCEK", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "nASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "N", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "NASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "nTTGEHCEK", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "nASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "N", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "NASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "", "site_lbl": "N104", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "6", "chr_pos": "112207132", "evidence": [ { "id": "Q16363", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q16363" } ], "disease": [ { "disease_id": "DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix.", "url": "http://disease-ontology.org/term/DOID:4362", "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "", "site_lbl": "N557", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "6", "chr_pos": "112158878", "evidence": [ { "id": "rs1554337654", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1554337654" }, { "id": "rs1554337654", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1554337654" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "6", "chr_pos": "112158879", "evidence": [ { "id": "rs1554337657", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1554337657" }, { "id": "rs1554337657", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1554337657" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "nTTGEHCEK", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "N", "site_lbl": "Asn104", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "nASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "N", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "NASGIYAEIDGAK", "site_lbl": "Asn557", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "104", "site_seq": "", "site_lbl": "N104", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "6", "chr_pos": "112207132", "evidence": [ { "id": "Q16363", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q16363" } ], "disease": [ { "disease_id": "DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix.", "url": "http://disease-ontology.org/term/DOID:4362", "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 104, "end_pos": 104, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "557", "site_seq": "", "site_lbl": "N557", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "6", "chr_pos": "112158878", "evidence": [ { "id": "rs1554337654", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1554337654" }, { "id": "rs1554337654", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1554337654" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "6", "chr_pos": "112158879", "evidence": [ { "id": "rs1554337657", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1554337657" }, { "id": "rs1554337657", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1554337657" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 557, "end_pos": 557, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "14", "chr_pos": "94383030", "evidence": [ { "id": "P01009", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01009" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "N", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "site_lbl": "Asn70", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "70", "site_seq": "", "site_lbl": "N70", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "14", "chr_pos": "94383030", "evidence": [ { "id": "P01009", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01009" } ], "disease": [ { "disease_id": "DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate.", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 70, "end_pos": 70, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "1034", "site_seq": "nTTSYVLR", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "N", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "NTTSYVLR", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "nTTSYVLR", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "N", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "NTTSYVLR", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "nTTSYVLR", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "N", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "NTTSYVLR", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "nTTSYVLR", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "N", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1034", "site_seq": "NTTSYVLR", "site_lbl": "Asn1034", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1034, "end_pos": 1034, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "201", "site_seq": "NGRPVHTSSTYSFSPQnNTLHIAPVTK", "site_lbl": "Asn201", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A8MVW5-1", "start_pos": 201, "end_pos": 201, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HEPACAM family member 2", "gene_name": "HEPACAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51407.0 } ] }, { "start_pos": "201", "site_seq": "NGRPVHTSSTYSFSPQnNTLHIAPVTK", "site_lbl": "Asn201", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A8MVW5-1", "start_pos": 201, "end_pos": 201, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HEPACAM family member 2", "gene_name": "HEPACAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51407.0 } ] }, { "start_pos": "201", "site_seq": "NGRPVHTSSTYSFSPQnNTLHIAPVTK", "site_lbl": "Asn201", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A8MVW5-1", "start_pos": 201, "end_pos": 201, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HEPACAM family member 2", "gene_name": "HEPACAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51407.0 } ] }, { "start_pos": "201", "site_seq": "", "site_lbl": "N201", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "7", "chr_pos": "93215513", "evidence": [ { "id": "rs767624363", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767624363" }, { "id": "rs767624363", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767624363" }, { "id": "rs767624363", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767624363#frequency_tab" }, { "id": "rs767624363", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767624363" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "7", "chr_pos": "93215514", "evidence": [ { "id": "rs893346874", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs893346874" }, { "id": "rs893346874", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs893346874" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "A8MVW5-1", "start_pos": 201, "end_pos": 201, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HEPACAM family member 2", "gene_name": "HEPACAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51407.0 } ] }, { "start_pos": "201", "site_seq": "NGRPVHTSSTYSFSPQnNTLHIAPVTK", "site_lbl": "Asn201", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "A8MVW5-1", "start_pos": 201, "end_pos": 201, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HEPACAM family member 2", "gene_name": "HEPACAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51407.0 } ] }, { "start_pos": "201", "site_seq": "", "site_lbl": "N201", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "7", "chr_pos": "93215513", "evidence": [ { "id": "rs767624363", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767624363" }, { "id": "rs767624363", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767624363" }, { "id": "rs767624363", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767624363#frequency_tab" }, { "id": "rs767624363", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767624363" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "7", "chr_pos": "93215514", "evidence": [ { "id": "rs893346874", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs893346874" }, { "id": "rs893346874", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs893346874" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "A8MVW5-1", "start_pos": 201, "end_pos": 201, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HEPACAM family member 2", "gene_name": "HEPACAM2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51407.0 } ] }, { "start_pos": "177", "site_seq": "IYVLDGTQnDTAFVFPR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "IYVLDGTQnDTAFVFPR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "IYVLDGTQnDTAFVFPR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "", "site_lbl": "N177", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "1", "chr_pos": "113981079", "evidence": [ { "id": "rs746449303", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746449303" }, { "id": "rs746449303", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746449303" }, { "id": "rs746449303", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746449303#frequency_tab" }, { "id": "rs746449303", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746449303" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "IYVLDGTQnDTAFVFPR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "177", "site_seq": "", "site_lbl": "N177", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "1", "chr_pos": "113981079", "evidence": [ { "id": "rs746449303", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746449303" }, { "id": "rs746449303", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746449303" }, { "id": "rs746449303", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746449303#frequency_tab" }, { "id": "rs746449303", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746449303" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NRN5-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Olfactomedin-like protein 3", "gene_name": "OLFML3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 46010.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "131", "site_seq": "nATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nVTYGTYLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "NATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nVTYGTYLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "NATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nVTYGTYLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "NATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "N", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "nVTYGTYLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "131", "site_seq": "NATYGYVLDDPDPDDGFNYK", "site_lbl": "Asn131", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43852-1", "start_pos": 131, "end_pos": 131, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Calumenin", "gene_name": "CALU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 315, "chemical_mass": 37107.0 } ] }, { "start_pos": "378", "site_seq": "GnTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "GNTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "GnTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "GNTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "GnTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "GNTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "2", "chr_pos": "33134893", "evidence": [ { "id": "Q14766", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14766" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "GnTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "GNTTTLISENGHAADTLTATNFR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "2", "chr_pos": "33134893", "evidence": [ { "id": "Q14766", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14766" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14766-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 1", "gene_name": "LTBP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1721, "chemical_mass": 186796.0 } ] }, { "start_pos": "438", "site_seq": "ELSVQDQPSLSPTSLQnSSSHTTTAK", "site_lbl": "Asn438", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95628-1", "start_pos": 438, "end_pos": 438, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CCR4-NOT transcription complex subunit 4", "gene_name": "CNOT4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 575, "chemical_mass": 63510.0 } ] }, { "start_pos": "438", "site_seq": "ELSVQDQPSLSPTSLQnSSSHTTTAK", "site_lbl": "Asn438", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95628-1", "start_pos": 438, "end_pos": 438, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CCR4-NOT transcription complex subunit 4", "gene_name": "CNOT4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 575, "chemical_mass": 63510.0 } ] }, { "start_pos": "438", "site_seq": "ELSVQDQPSLSPTSLQnSSSHTTTAK", "site_lbl": "Asn438", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95628-1", "start_pos": 438, "end_pos": 438, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CCR4-NOT transcription complex subunit 4", "gene_name": "CNOT4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 575, "chemical_mass": 63510.0 } ] }, { "start_pos": "438", "site_seq": "", "site_lbl": "N438", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->ISS).", "chr_id": "7", "chr_pos": "135394232", "evidence": [ { "id": "rs1043577436", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1043577436" }, { "id": "rs1043577436", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1043577436" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "7", "chr_pos": "135394231", "evidence": [ { "id": "rs1796558680", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1796558680" }, { "id": "rs1796558680", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1796558680" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95628-1", "start_pos": 438, "end_pos": 438, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CCR4-NOT transcription complex subunit 4", "gene_name": "CNOT4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 575, "chemical_mass": 63510.0 } ] }, { "start_pos": "438", "site_seq": "ELSVQDQPSLSPTSLQnSSSHTTTAK", "site_lbl": "Asn438", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95628-1", "start_pos": 438, "end_pos": 438, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CCR4-NOT transcription complex subunit 4", "gene_name": "CNOT4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 575, "chemical_mass": 63510.0 } ] }, { "start_pos": "438", "site_seq": "", "site_lbl": "N438", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->ISS).", "chr_id": "7", "chr_pos": "135394232", "evidence": [ { "id": "rs1043577436", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1043577436" }, { "id": "rs1043577436", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1043577436" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "7", "chr_pos": "135394231", "evidence": [ { "id": "rs1796558680", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1796558680" }, { "id": "rs1796558680", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1796558680" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95628-1", "start_pos": 438, "end_pos": 438, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CCR4-NOT transcription complex subunit 4", "gene_name": "CNOT4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 575, "chemical_mass": 63510.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPnQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPnQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPnQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "", "site_lbl": "N362", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "12", "chr_pos": "64737018", "evidence": [ { "id": "rs1046086978", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1046086978" }, { "id": "rs1046086978", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1046086978#frequency_tab" }, { "id": "rs1046086978", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1046086978" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "rs1869575584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1869575584" }, { "id": "rs1869575584", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1869575584" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "P15586", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P15586" } ], "disease": [ { "disease_id": "DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder.", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPnQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "", "site_lbl": "N362", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "12", "chr_pos": "64737018", "evidence": [ { "id": "rs1046086978", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1046086978" }, { "id": "rs1046086978", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1046086978#frequency_tab" }, { "id": "rs1046086978", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1046086978" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "rs1869575584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1869575584" }, { "id": "rs1869575584", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1869575584" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "P15586", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P15586" } ], "disease": [ { "disease_id": "DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder.", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "", "site_lbl": "N453", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "11", "chr_pos": "6431242", "evidence": [ { "id": "rs768990038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768990038#frequency_tab" }, { "id": "rs768990038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768990038" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "", "site_lbl": "N453", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "11", "chr_pos": "6431242", "evidence": [ { "id": "rs768990038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768990038#frequency_tab" }, { "id": "rs768990038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768990038" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "555", "site_seq": "HQVSInNTAVMQR", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "HQVSINNTAVMQR", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "N", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "HQVSInNTAVMQR", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "HQVSINNTAVMQR", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "N", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "HQVSInNTAVMQR", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "HQVSINNTAVMQR", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "N", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "", "site_lbl": "N555", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "18", "chr_pos": "7037651", "evidence": [ { "id": "rs1568041333", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1568041333" }, { "id": "rs1568041333", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1568041333" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "HQVSInNTAVMQR", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "HQVSINNTAVMQR", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "N", "site_lbl": "Asn555", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "555", "site_seq": "", "site_lbl": "N555", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "18", "chr_pos": "7037651", "evidence": [ { "id": "rs1568041333", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1568041333" }, { "id": "rs1568041333", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1568041333" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25391-1", "start_pos": 555, "end_pos": 555, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-1", "gene_name": "LAMA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3075, "chemical_mass": 337084.0 } ] }, { "start_pos": "105", "site_seq": "APGWAnSSAGSGR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "105", "site_seq": "APGWAnSSAGSGR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "105", "site_seq": "APGWAnSSAGSGR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "12", "chr_pos": "7501282", "evidence": [ { "id": "rs1949484624", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1949484624" }, { "id": "rs1949484624", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1949484624" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->TSS).", "chr_id": "NC_000012.12", "chr_pos": "7501282", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "105", "site_seq": "APGWAnSSAGSGR", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "12", "chr_pos": "7501282", "evidence": [ { "id": "rs1949484624", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1949484624" }, { "id": "rs1949484624", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1949484624" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->TSS).", "chr_id": "NC_000012.12", "chr_pos": "7501282", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86VB7-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1156, "chemical_mass": 125451.0 } ] }, { "start_pos": "259", "site_seq": "RSDAnCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "SDAnCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "RSDANCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "N", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "RSDAnCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "SDAnCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "RSDANCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "N", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "RSDAnCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "SDAnCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "RSDANCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "N", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "", "site_lbl": "N259", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "18", "chr_pos": "11886591", "evidence": [ { "id": "rs760134169", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760134169" }, { "id": "rs760134169", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760134169" }, { "id": "rs760134169", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760134169" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "18", "chr_pos": "11886589", "evidence": [ { "id": "rs749991313", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749991313" }, { "id": "rs749991313", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749991313" }, { "id": "rs749991313", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749991313#frequency_tab" }, { "id": "rs749991313", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749991313" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "RSDAnCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "SDAnCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "RSDANCSGEDAAPAEER", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "N", "site_lbl": "Asn259", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "259", "site_seq": "", "site_lbl": "N259", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "18", "chr_pos": "11886591", "evidence": [ { "id": "rs760134169", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760134169" }, { "id": "rs760134169", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760134169" }, { "id": "rs760134169", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760134169" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "18", "chr_pos": "11886589", "evidence": [ { "id": "rs749991313", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749991313" }, { "id": "rs749991313", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749991313" }, { "id": "rs749991313", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749991313#frequency_tab" }, { "id": "rs749991313", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749991313" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q53F39-1", "start_pos": 259, "end_pos": 259, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metallophosphoesterase 1", "gene_name": "MPPE1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 396, "chemical_mass": 45141.0 } ] }, { "start_pos": "103", "site_seq": "SnYTPITNVPPEVTVLTNSPVELR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "RSnYTPITNVPPEVTVLTNSPVELR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "SnYTPITNVPPEVTVLTNSPVELR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "RSnYTPITNVPPEVTVLTNSPVELR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "SnYTPITNVPPEVTVLTNSPVELR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "RSnYTPITNVPPEVTVLTNSPVELR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "6", "chr_pos": "32442673", "evidence": [ { "id": "P01903", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01903" }, { "id": "rs1450907470", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1450907470" }, { "id": "rs1450907470", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1450907470#frequency_tab" }, { "id": "rs1450907470", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1450907470" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "SnYTPITNVPPEVTVLTNSPVELR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "RSnYTPITNVPPEVTVLTNSPVELR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "6", "chr_pos": "32442673", "evidence": [ { "id": "P01903", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01903" }, { "id": "rs1450907470", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1450907470" }, { "id": "rs1450907470", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1450907470#frequency_tab" }, { "id": "rs1450907470", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1450907470" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01903-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR alpha chain", "gene_name": "HLA-DRA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 254, "chemical_mass": 28621.0 } ] }, { "start_pos": "67", "site_seq": "GHEVTVLASSASILFDPnNSSALK", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "N", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "GHEVTVLASSASILFDPnNSSALK", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "N", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "GHEVTVLASSASILFDPnNSSALK", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "N", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "", "site_lbl": "N67", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "4", "chr_pos": "69096719", "evidence": [ { "id": "rs748435925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748435925" }, { "id": "rs748435925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748435925" }, { "id": "rs748435925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748435925" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "GHEVTVLASSASILFDPnNSSALK", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "N", "site_lbl": "Asn67", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "67", "site_seq": "", "site_lbl": "N67", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "4", "chr_pos": "69096719", "evidence": [ { "id": "rs748435925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748435925" }, { "id": "rs748435925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748435925" }, { "id": "rs748435925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748435925" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16662-1", "start_pos": 67, "end_pos": 67, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 529, "chemical_mass": 60721.0 } ] }, { "start_pos": "398", "site_seq": "QEHQVLLQELPGSEHIEMLAnATTLAYLK", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "398", "site_seq": "QEHQVLLQELPGSEHIEMLAnATTLAYLK", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "398", "site_seq": "QEHQVLLQELPGSEHIEMLAnATTLAYLK", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "398", "site_seq": "", "site_lbl": "N398", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "16", "chr_pos": "68259611", "evidence": [ { "id": "rs928127490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs928127490" }, { "id": "rs928127490", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs928127490" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "398", "site_seq": "QEHQVLLQELPGSEHIEMLAnATTLAYLK", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "398", "site_seq": "", "site_lbl": "N398", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "16", "chr_pos": "68259611", "evidence": [ { "id": "rs928127490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs928127490" }, { "id": "rs928127490", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs928127490" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "398", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of glycosylation site. Slightly reduces production of the mature, active enzyme.", "evidence": [ { "database": "UniProtKB", "id": "Q8NCC3", "url": "https://www.uniprot.org/uniprotkb/Q8NCC3" }, { "database": "PubMed", "id": "23958596", "url": "https://glygen.org/publication/PubMed/23958596" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8NCC3-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal phospholipase A and acyltransferase", "gene_name": "PLA2G15", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 46658.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "", "site_lbl": "N469", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "1", "chr_pos": "206934719", "evidence": [ { "id": "rs767674762", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767674762#frequency_tab" }, { "id": "rs767674762", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767674762" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "", "site_lbl": "N469", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "1", "chr_pos": "206934719", "evidence": [ { "id": "rs767674762", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767674762#frequency_tab" }, { "id": "rs767674762", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767674762" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "11", "chr_pos": "1754946", "evidence": [ { "id": "rs1845791989", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1845791989" }, { "id": "rs1845791989", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1845791989" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "1754945", "evidence": [ { "id": "rs1248669413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248669413" }, { "id": "rs1248669413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248669413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "11", "chr_pos": "1754946", "evidence": [ { "id": "rs1845791989", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1845791989" }, { "id": "rs1845791989", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1845791989" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "1754945", "evidence": [ { "id": "rs1248669413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248669413" }, { "id": "rs1248669413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248669413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "247", "site_seq": "CGALQGLYTTVDFGTGSnITDAFLSQR", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "N", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "CGALQGLYTTVDFGTGSNITDAFLSQR", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "CGALQGLYTTVDFGTGSnITDAFLSQR", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "N", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "CGALQGLYTTVDFGTGSNITDAFLSQR", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "CGALQGLYTTVDFGTGSnITDAFLSQR", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "N", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "CGALQGLYTTVDFGTGSNITDAFLSQR", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "CGALQGLYTTVDFGTGSnITDAFLSQR", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "N", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "247", "site_seq": "CGALQGLYTTVDFGTGSNITDAFLSQR", "site_lbl": "Asn247", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16278-1", "start_pos": 247, "end_pos": 247, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-galactosidase", "gene_name": "GLB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 677, "chemical_mass": 76075.0 } ] }, { "start_pos": "101", "site_seq": "SHnRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "N", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "SHNRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "SHnRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "N", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "SHNRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "SHnRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "N", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "SHNRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "", "site_lbl": "N101", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRS->SRS).", "chr_id": "23", "chr_pos": "47585305", "evidence": [ { "id": "P01033", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01033" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "SHnRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "N", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "SHNRSEEFLIAGK", "site_lbl": "Asn101", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "101", "site_seq": "", "site_lbl": "N101", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRS->SRS).", "chr_id": "23", "chr_pos": "47585305", "evidence": [ { "id": "P01033", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01033" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01033-1", "start_pos": 101, "end_pos": 101, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 207, "chemical_mass": 23171.0 } ] }, { "start_pos": "586", "site_seq": "CHAGYIGDNCnCSTDISTCR", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "N", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "CHAGYIGDNCNCSTDISTCR", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "CHAGYIGDNCnCSTDISTCR", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "N", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "CHAGYIGDNCNCSTDISTCR", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "CHAGYIGDNCnCSTDISTCR", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "N", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "CHAGYIGDNCNCSTDISTCR", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "", "site_lbl": "N586", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "3", "chr_pos": "124773850", "evidence": [ { "id": "rs1327646822", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1327646822" }, { "id": "rs1327646822", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1327646822" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "CHAGYIGDNCnCSTDISTCR", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "N", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "CHAGYIGDNCNCSTDISTCR", "site_lbl": "Asn586", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "586", "site_seq": "", "site_lbl": "N586", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "3", "chr_pos": "124773850", "evidence": [ { "id": "rs1327646822", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1327646822" }, { "id": "rs1327646822", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1327646822" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P18084-1", "start_pos": 586, "end_pos": 586, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 799, "chemical_mass": 88054.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "88312517", "evidence": [ { "id": "rs576632189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576632189" }, { "id": "rs576632189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576632189" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "88312517", "evidence": [ { "id": "rs576632189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576632189" }, { "id": "rs576632189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576632189" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "415", "site_seq": "nISSHTNIVFSNGELDPWSGGGVTK", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "NISSHTNIVFSNGELDPWSGGGVTK", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "nISSHTNIVFSNGELDPWSGGGVTK", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "NISSHTNIVFSNGELDPWSGGGVTK", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "nISSHTNIVFSNGELDPWSGGGVTK", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "NISSHTNIVFSNGELDPWSGGGVTK", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "", "site_lbl": "N415", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "11", "chr_pos": "82838418", "evidence": [ { "id": "rs140748781", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140748781" }, { "id": "rs140748781", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140748781" }, { "id": "rs140748781", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140748781#frequency_tab" }, { "id": "rs140748781", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140748781" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "nISSHTNIVFSNGELDPWSGGGVTK", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "N", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "NISSHTNIVFSNGELDPWSGGGVTK", "site_lbl": "Asn415", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "415", "site_seq": "", "site_lbl": "N415", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "11", "chr_pos": "82838418", "evidence": [ { "id": "rs140748781", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140748781" }, { "id": "rs140748781", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140748781" }, { "id": "rs140748781", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140748781#frequency_tab" }, { "id": "rs140748781", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140748781" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P42785-1", "start_pos": 415, "end_pos": 415, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysosomal Pro-X carboxypeptidase", "gene_name": "PRCP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 496, "chemical_mass": 55800.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "269", "site_seq": "GTEVnTTVIGENDPIDEVQGFLFGK", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "GTEVNTTVIGENDPIDEVQGFLFGK", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "N", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "GTEVnTTVIGENDPIDEVQGFLFGK", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "GTEVNTTVIGENDPIDEVQGFLFGK", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "N", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "GTEVnTTVIGENDPIDEVQGFLFGK", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "GTEVNTTVIGENDPIDEVQGFLFGK", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "N", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "", "site_lbl": "N269", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "128116277", "evidence": [ { "id": "rs1688096150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1688096150" }, { "id": "rs1688096150", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1688096150" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "GTEVnTTVIGENDPIDEVQGFLFGK", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "GTEVNTTVIGENDPIDEVQGFLFGK", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "N", "site_lbl": "Asn269", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "269", "site_seq": "", "site_lbl": "N269", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "2", "chr_pos": "128116277", "evidence": [ { "id": "rs1688096150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1688096150" }, { "id": "rs1688096150", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1688096150" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NYU2-1", "start_pos": 269, "end_pos": 269, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "UDP-glucose:glycoprotein glucosyltransferase 1", "gene_name": "UGGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1555, "chemical_mass": 177190.0 } ] }, { "start_pos": "322", "site_seq": "QDFnITDISLLEHR", "site_lbl": "Asn322", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "322", "site_seq": "N", "site_lbl": "Asn322", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "322", "site_seq": "QDFnITDISLLEHR", "site_lbl": "Asn322", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "322", "site_seq": "N", "site_lbl": "Asn322", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "322", "site_seq": "QDFnITDISLLEHR", "site_lbl": "Asn322", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "322", "site_seq": "N", "site_lbl": "Asn322", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "322", "site_seq": "", "site_lbl": "N322", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "16", "chr_pos": "20348230", "evidence": [ { "id": "rs759032284", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759032284" }, { "id": "rs759032284", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759032284" }, { "id": "rs759032284", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759032284" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "16", "chr_pos": "20348231", "evidence": [ { "id": "rs765984547", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765984547" }, { "id": "rs765984547", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765984547" }, { "id": "rs765984547", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765984547" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "322", "site_seq": "QDFnITDISLLEHR", "site_lbl": "Asn322", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "322", "site_seq": "N", "site_lbl": "Asn322", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "322", "site_seq": "", "site_lbl": "N322", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "16", "chr_pos": "20348230", "evidence": [ { "id": "rs759032284", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759032284" }, { "id": "rs759032284", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759032284" }, { "id": "rs759032284", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759032284" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "16", "chr_pos": "20348231", "evidence": [ { "id": "rs765984547", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765984547" }, { "id": "rs765984547", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765984547" }, { "id": "rs765984547", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765984547" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 322, "end_pos": 322, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISnLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "N", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISNLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISnLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "N", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISNLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISnLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "N", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISNLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "", "site_lbl": "N113", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "10", "chr_pos": "73068972", "evidence": [ { "id": "rs764044557", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764044557" }, { "id": "rs764044557", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764044557" }, { "id": "rs764044557", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764044557" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISnLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "N", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "DMSDGFISNLTIQR", "site_lbl": "Asn113", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "113", "site_seq": "", "site_lbl": "N113", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "10", "chr_pos": "73068972", "evidence": [ { "id": "rs764044557", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764044557" }, { "id": "rs764044557", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764044557" }, { "id": "rs764044557", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764044557" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13674-1", "start_pos": 113, "end_pos": 113, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolyl 4-hydroxylase subunit alpha-1", "gene_name": "P4HA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 534, "chemical_mass": 61049.0 } ] }, { "start_pos": "125", "site_seq": "DAGVVCTnETR", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "GLnLTEDTYKPR", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "DAGVVCTnETR", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "GLnLTEDTYKPR", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "DAGVVCTnETR", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "GLnLTEDTYKPR", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "17", "chr_pos": "78974689", "evidence": [ { "id": "rs778454792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778454792" }, { "id": "rs778454792", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778454792#frequency_tab" }, { "id": "rs778454792", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778454792" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "17", "chr_pos": "78974690", "evidence": [ { "id": "Q08380", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q08380" }, { "id": "rs1461262648", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1461262648" }, { "id": "rs1461262648", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1461262648" }, { "id": "rs1461262648", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1461262648" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "", "site_lbl": "N398", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "17", "chr_pos": "78972140", "evidence": [ { "id": "rs923974095", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs923974095" }, { "id": "rs923974095", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs923974095#frequency_tab" }, { "id": "rs923974095", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs923974095" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "DAGVVCTnETR", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "N", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "GLnLTEDTYKPR", "site_lbl": "Asn398", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "17", "chr_pos": "78974689", "evidence": [ { "id": "rs778454792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778454792" }, { "id": "rs778454792", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778454792#frequency_tab" }, { "id": "rs778454792", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778454792" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "17", "chr_pos": "78974690", "evidence": [ { "id": "Q08380", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q08380" }, { "id": "rs1461262648", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1461262648" }, { "id": "rs1461262648", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1461262648" }, { "id": "rs1461262648", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1461262648" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "398", "site_seq": "", "site_lbl": "N398", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "17", "chr_pos": "78972140", "evidence": [ { "id": "rs923974095", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs923974095" }, { "id": "rs923974095", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs923974095#frequency_tab" }, { "id": "rs923974095", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs923974095" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q08380-1", "start_pos": 398, "end_pos": 398, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 585, "chemical_mass": 65331.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "72060219", "evidence": [ { "id": "rs375137689", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375137689#frequency_tab" }, { "id": "rs375137689", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375137689" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "72060219", "evidence": [ { "id": "rs375137689", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375137689#frequency_tab" }, { "id": "rs375137689", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375137689" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "170", "site_seq": "GFnTSFLVNIATIFESENFFLPGIK", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Z0-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-secretase 2", "gene_name": "BACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 518, "chemical_mass": 56180.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Z0-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-secretase 2", "gene_name": "BACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 518, "chemical_mass": 56180.0 } ] }, { "start_pos": "170", "site_seq": "GFnTSFLVNIATIFESENFFLPGIK", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Z0-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-secretase 2", "gene_name": "BACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 518, "chemical_mass": 56180.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Z0-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-secretase 2", "gene_name": "BACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 518, "chemical_mass": 56180.0 } ] }, { "start_pos": "170", "site_seq": "GFnTSFLVNIATIFESENFFLPGIK", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Z0-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-secretase 2", "gene_name": "BACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 518, "chemical_mass": 56180.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Z0-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-secretase 2", "gene_name": "BACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 518, "chemical_mass": 56180.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "N170", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "21", "chr_pos": "41237620", "evidence": [ { "id": "rs1047819117", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1047819117" }, { "id": "rs1047819117", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1047819117#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Z0-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-secretase 2", "gene_name": "BACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 518, "chemical_mass": 56180.0 } ] }, { "start_pos": "170", "site_seq": "GFnTSFLVNIATIFESENFFLPGIK", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Z0-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-secretase 2", "gene_name": "BACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 518, "chemical_mass": 56180.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Z0-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-secretase 2", "gene_name": "BACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 518, "chemical_mass": 56180.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "N170", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "21", "chr_pos": "41237620", "evidence": [ { "id": "rs1047819117", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1047819117" }, { "id": "rs1047819117", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1047819117#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y5Z0-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-secretase 2", "gene_name": "BACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 518, "chemical_mass": 56180.0 } ] }, { "start_pos": "179", "site_seq": "IVVYNQPYInYSR", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "N", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "IVVYNQPYINYSR", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "IVVYNQPYInYSR", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "N", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "IVVYNQPYINYSR", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "IVVYNQPYInYSR", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "N", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "IVVYNQPYINYSR", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "", "site_lbl": "N179", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "8", "chr_pos": "96835074", "evidence": [ { "id": "rs747685101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747685101" }, { "id": "rs747685101", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747685101" }, { "id": "rs747685101", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747685101" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "8", "chr_pos": "96835075", "evidence": [ { "id": "rs1244348503", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244348503" }, { "id": "rs1244348503", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1244348503#frequency_tab" }, { "id": "rs1244348503", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244348503" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "IVVYNQPYInYSR", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "N", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "IVVYNQPYINYSR", "site_lbl": "Asn179", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "179", "site_seq": "", "site_lbl": "N179", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "8", "chr_pos": "96835074", "evidence": [ { "id": "rs747685101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747685101" }, { "id": "rs747685101", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747685101" }, { "id": "rs747685101", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747685101" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "8", "chr_pos": "96835075", "evidence": [ { "id": "rs1244348503", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244348503" }, { "id": "rs1244348503", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1244348503#frequency_tab" }, { "id": "rs1244348503", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244348503" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y646-1", "start_pos": 179, "end_pos": 179, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Carboxypeptidase Q", "gene_name": "CPQ", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 472, "chemical_mass": 51888.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "7", "chr_pos": "99971758", "evidence": [ { "id": "rs147067825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147067825#frequency_tab" }, { "id": "rs147067825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147067825" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "7", "chr_pos": "99971757", "evidence": [ { "id": "rs1305659520", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305659520" }, { "id": "rs1305659520", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1305659520" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "7", "chr_pos": "99971747", "evidence": [ { "id": "rs200393898", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200393898#frequency_tab" }, { "id": "rs200393898", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200393898" }, { "id": "rs141506204", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141506204" }, { "id": "rs141506204", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141506204#frequency_tab" }, { "id": "rs141506204", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141506204" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "7", "chr_pos": "99971748", "evidence": [ { "id": "rs1454741051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1454741051" }, { "id": "rs1454741051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1454741051#frequency_tab" }, { "id": "rs1454741051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1454741051" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "7", "chr_pos": "99971758", "evidence": [ { "id": "rs147067825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147067825#frequency_tab" }, { "id": "rs147067825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147067825" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "7", "chr_pos": "99971757", "evidence": [ { "id": "rs1305659520", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305659520" }, { "id": "rs1305659520", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1305659520" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "7", "chr_pos": "99971747", "evidence": [ { "id": "rs200393898", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200393898#frequency_tab" }, { "id": "rs200393898", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200393898" }, { "id": "rs141506204", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141506204" }, { "id": "rs141506204", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141506204#frequency_tab" }, { "id": "rs141506204", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141506204" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "7", "chr_pos": "99971748", "evidence": [ { "id": "rs1454741051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1454741051" }, { "id": "rs1454741051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1454741051#frequency_tab" }, { "id": "rs1454741051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1454741051" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "1416", "site_seq": "TLnLTDVIEELAQASTQTLK", "site_lbl": "Asn1416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6WRI0-1", "start_pos": 1416, "end_pos": 1416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 10", "gene_name": "IGSF10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2623, "chemical_mass": 290838.0 } ] }, { "start_pos": "1416", "site_seq": "TLnLTDVIEELAQASTQTLK", "site_lbl": "Asn1416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6WRI0-1", "start_pos": 1416, "end_pos": 1416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 10", "gene_name": "IGSF10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2623, "chemical_mass": 290838.0 } ] }, { "start_pos": "1416", "site_seq": "TLnLTDVIEELAQASTQTLK", "site_lbl": "Asn1416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6WRI0-1", "start_pos": 1416, "end_pos": 1416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 10", "gene_name": "IGSF10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2623, "chemical_mass": 290838.0 } ] }, { "start_pos": "1416", "site_seq": "TLnLTDVIEELAQASTQTLK", "site_lbl": "Asn1416", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6WRI0-1", "start_pos": 1416, "end_pos": 1416, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Immunoglobulin superfamily member 10", "gene_name": "IGSF10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2623, "chemical_mass": 290838.0 } ] }, { "start_pos": "48", "site_seq": "YECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "YECHFFNGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "YECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "YECHFFNGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "YECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "YECHFFNGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "YECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "YECHFFNGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q30154-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 30056.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFnGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFNGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFnGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFNGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFnGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFNGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFnGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "QECYAFNGTQR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04440-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DP beta 1 chain", "gene_name": "HLA-DPB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 258, "chemical_mass": 29159.0 } ] }, { "start_pos": "48", "site_seq": "CHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "HECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "FLEYSTSECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "ECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "RECHFFNGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "CHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "HECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "FLEYSTSECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "ECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "RECHFFNGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "CHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "HECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "FLEYSTSECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "ECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "RECHFFNGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "", "site_lbl": "N48", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "6", "chr_pos": "32584336", "evidence": [ { "id": "rs1776055186", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1776055186" }, { "id": "rs1776055186", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1776055186" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "CHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "HECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "FLEYSTSECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "ECHFFnGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "RECHFFNGTER", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "48", "site_seq": "", "site_lbl": "N48", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "6", "chr_pos": "32584336", "evidence": [ { "id": "rs1776055186", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1776055186" }, { "id": "rs1776055186", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1776055186" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01911-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 266, "chemical_mass": 29966.0 } ] }, { "start_pos": "341", "site_seq": "HFFnVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFNVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFnVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFNVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFnVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFNVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "", "site_lbl": "N341", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->IVS).", "chr_id": "5", "chr_pos": "52893772", "evidence": [ { "id": "P56199", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P56199" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "5", "chr_pos": "52893772", "evidence": [ { "id": "rs1415396844", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1415396844" }, { "id": "rs1415396844", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1415396844#frequency_tab" }, { "id": "rs1415396844", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1415396844" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFnVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "HFFNVSDELALVTIVK", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "N", "site_lbl": "Asn341", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "341", "site_seq": "", "site_lbl": "N341", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVS->IVS).", "chr_id": "5", "chr_pos": "52893772", "evidence": [ { "id": "P56199", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P56199" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "5", "chr_pos": "52893772", "evidence": [ { "id": "rs1415396844", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1415396844" }, { "id": "rs1415396844", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1415396844#frequency_tab" }, { "id": "rs1415396844", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1415396844" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P56199-1", "start_pos": 341, "end_pos": 341, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin alpha-1", "gene_name": "ITGA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 130848.0 } ] }, { "start_pos": "3257", "site_seq": "LLLGGLPESGTIYnFSGCISNVFVQR", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "LLLGGLPESGTIYNFSGCISNVFVQR", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "N", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "LLLGGLPESGTIYnFSGCISNVFVQR", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "LLLGGLPESGTIYNFSGCISNVFVQR", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "N", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "LLLGGLPESGTIYnFSGCISNVFVQR", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "LLLGGLPESGTIYNFSGCISNVFVQR", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "N", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "", "site_lbl": "N3257", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "20", "chr_pos": "62311650", "evidence": [ { "id": "rs1346604531", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1346604531" }, { "id": "rs1346604531", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1346604531#frequency_tab" }, { "id": "rs1346604531", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1346604531" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "LLLGGLPESGTIYnFSGCISNVFVQR", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "LLLGGLPESGTIYNFSGCISNVFVQR", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "N", "site_lbl": "Asn3257", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "3257", "site_seq": "", "site_lbl": "N3257", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "20", "chr_pos": "62311650", "evidence": [ { "id": "rs1346604531", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1346604531" }, { "id": "rs1346604531", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1346604531#frequency_tab" }, { "id": "rs1346604531", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1346604531" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 3257, "end_pos": 3257, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "217", "site_seq": "HNnDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "HNNDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "HNnDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "HNNDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "HNnDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "HNNDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "", "site_lbl": "N217", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "12", "chr_pos": "103934194", "evidence": [ { "id": "rs371098260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371098260" }, { "id": "rs371098260", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371098260" }, { "id": "rs371098260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371098260#frequency_tab" }, { "id": "rs371098260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371098260" }, { "id": "rs371098260", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371098260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "", "site_lbl": "N62", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "12", "chr_pos": "103932308", "evidence": [ { "id": "P14625", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P14625" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "HNnDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "N", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "HNNDTQHIWESDSNEFSVIADPR", "site_lbl": "Asn217", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "", "site_lbl": "N217", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "12", "chr_pos": "103934194", "evidence": [ { "id": "rs371098260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371098260" }, { "id": "rs371098260", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371098260" }, { "id": "rs371098260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371098260#frequency_tab" }, { "id": "rs371098260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371098260" }, { "id": "rs371098260", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371098260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "", "site_lbl": "N62", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "12", "chr_pos": "103932308", "evidence": [ { "id": "P14625", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P14625" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "217", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Does not promote or impair hyperglycosylation.", "evidence": [ { "database": "UniProtKB", "id": "P14625", "url": "https://www.uniprot.org/uniprotkb/P14625" }, { "database": "PubMed", "id": "31296534", "url": "https://glygen.org/publication/PubMed/31296534" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 217, "end_pos": 217, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "551", "site_seq": "EGKPFYQMTSnATQAFWTK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "EGKPFYQMTSnATQAFWTK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "EGKPFYQMTSnATQAFWTK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "", "site_lbl": "N551", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "17", "chr_pos": "64356239", "evidence": [ { "id": "rs2035842772", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2035842772" }, { "id": "rs2035842772", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2035842772" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "EGKPFYQMTSnATQAFWTK", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] }, { "start_pos": "551", "site_seq": "", "site_lbl": "N551", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "17", "chr_pos": "64356239", "evidence": [ { "id": "rs2035842772", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2035842772" }, { "id": "rs2035842772", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2035842772" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16284-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 738, "chemical_mass": 82522.0 } ] } ], "record_id": "G01485JJ" }