{ "glytoucan_ac": "G00406II", "species": [ { "taxid": 9913, "name": "Bos taurus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "345", "url": "https://glyconnect.expasy.org/browser/compositions/345" }, { "database": "PubMed", "id": "11520036", "url": "https://glygen.org/publication/PubMed/11520036" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" }, { "taxid": 7227, "name": "Drosophila melanogaster", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "345", "url": "https://glyconnect.expasy.org/browser/compositions/345" }, { "database": "PubMed", "id": "11382750", "url": "https://glygen.org/publication/PubMed/11382750" }, { "database": "PubMed", "id": "16897177", "url": "https://glygen.org/publication/PubMed/16897177" }, { "database": "PubMed", "id": "17264077", "url": "https://glygen.org/publication/PubMed/17264077" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" }, { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "both", "evidence": [ { "database": "GlyConnect", "id": "345", "url": "https://glyconnect.expasy.org/browser/compositions/345" }, { "database": "PubMed", "id": "10814696", "url": "https://glygen.org/publication/PubMed/10814696" }, { "database": "PubMed", "id": "11425797", "url": "https://glygen.org/publication/PubMed/11425797" }, { "database": "PubMed", "id": "11787698", "url": "https://glygen.org/publication/PubMed/11787698" }, { "database": "PubMed", "id": "20578730", "url": "https://glygen.org/publication/PubMed/20578730" }, { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "PubMed", "id": "26613816", "url": "https://glygen.org/publication/PubMed/26613816" }, { "database": "PubMed", "id": "28630345", "url": "https://glygen.org/publication/PubMed/28630345" }, { "database": "PubMed", "id": "29053807", "url": "https://glygen.org/publication/PubMed/29053807" }, { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "PubMed", "id": "29969231", "url": "https://glygen.org/publication/PubMed/29969231" }, { "database": "PubMed", "id": "31409852", "url": "https://glygen.org/publication/PubMed/31409852" }, { "database": "PubMed", "id": "32639750", "url": "https://glygen.org/publication/PubMed/32639750" }, { "database": "PubMed", "id": "677898", "url": "https://glygen.org/publication/PubMed/677898" }, { "database": "Subsumption", "id": "G37830TX", "url": "https://www.glygen.org/glycan/G37830TX" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "both", "evidence": [ { "database": "GlyConnect", "id": "345", "url": "https://glyconnect.expasy.org/browser/compositions/345" }, { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "PubMed", "id": "35022400", "url": "https://glygen.org/publication/PubMed/35022400" }, { "database": "Subsumption", "id": "G37830TX", "url": "https://www.glygen.org/glycan/G37830TX" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" }, { "taxid": 9823, "name": "Sus scrofa", "annotation_category": "subsumption", "evidence": [ { "database": "Subsumption", "id": "G06850AE", "url": "https://www.glygen.org/glycan/G06850AE" }, { "database": "Subsumption", "id": "G37830TX", "url": "https://www.glygen.org/glycan/G37830TX" }, { "database": "Subsumption", "id": "G99867KU", "url": "https://www.glygen.org/glycan/G99867KU" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" }, { "taxid": 10116, "name": "Rattus norvegicus", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "345", "url": "https://glyconnect.expasy.org/browser/compositions/345" }, { "database": "PubMed", "id": "33242084", "url": "https://glygen.org/publication/PubMed/33242084" }, { "database": "PubMed", "id": "34106099", "url": "https://glygen.org/publication/PubMed/34106099" }, { "database": "PubMed", "id": "8612632", "url": "https://glygen.org/publication/PubMed/8612632" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" }, { "taxid": 2697049, "name": "Severe acute respiratory syndrome coronavirus 2", "annotation_category": "direct", "evidence": [ { "database": "GlyConnect", "id": "345", "url": "https://glyconnect.expasy.org/browser/compositions/345" }, { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" } ], "common_name": "2019-nCoV", "glygen_name": "SARS-CoV-2", "reference_species": "Severe acute respiratory syndrome coronavirus 2 [2697049]" } ], "mass": 1218.44, "classification": [ { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Ganglio series" } }, { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Globo series" } }, { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Isoglobo series" } }, { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Lacto series" } }, { "type": { "name": "Glycosphingolipid" }, "subtype": { "name": "Neo-lacto series" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Monoantennary" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 1, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 4, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 2, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02771-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "41", "url": "https://glyconnect.expasy.org/browser/proteins/41" } ], "protein_name": "Alpha-fetoprotein", "gene_name": "AFP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 609, "chemical_mass": 68678.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02771-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "41", "url": "https://glyconnect.expasy.org/browser/proteins/41" } ], "protein_name": "Alpha-fetoprotein", "gene_name": "AFP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 609, "chemical_mass": 68678.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02771-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "41", "url": "https://glyconnect.expasy.org/browser/proteins/41" } ], "protein_name": "Alpha-fetoprotein", "gene_name": "AFP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 609, "chemical_mass": 68678.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02771-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "41", "url": "https://glyconnect.expasy.org/browser/proteins/41" } ], "protein_name": "Alpha-fetoprotein", "gene_name": "AFP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 609, "chemical_mass": 68678.0 } ] }, { "start_pos": "971", "site_seq": "N", "site_lbl": "Asn971", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30622-3", "start_pos": 971, "end_pos": 971, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "643", "url": "https://glyconnect.expasy.org/browser/proteins/643" } ], "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1438, "chemical_mass": 162246.0 } ] }, { "start_pos": "971", "site_seq": "N", "site_lbl": "Asn971", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30622-3", "start_pos": 971, "end_pos": 971, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "643", "url": "https://glyconnect.expasy.org/browser/proteins/643" } ], "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1438, "chemical_mass": 162246.0 } ] }, { "start_pos": "971", "site_seq": "N", "site_lbl": "Asn971", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30622-3", "start_pos": 971, "end_pos": 971, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "643", "url": "https://glyconnect.expasy.org/browser/proteins/643" } ], "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1438, "chemical_mass": 162246.0 } ] }, { "start_pos": "971", "site_seq": "N", "site_lbl": "Asn971", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P30622-3", "start_pos": 971, "end_pos": 971, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "643", "url": "https://glyconnect.expasy.org/browser/proteins/643" } ], "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1438, "chemical_mass": 162246.0 } ] }, { "start_pos": "292", "site_seq": "N", "site_lbl": "Asn292", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 292, "end_pos": 292, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "292", "site_seq": "LQLTWLENGnVSR", "site_lbl": "Asn292", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 292, "end_pos": 292, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "292", "site_seq": "N", "site_lbl": "Asn292", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 292, "end_pos": 292, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "292", "site_seq": "LQLTWLENGnVSR", "site_lbl": "Asn292", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 292, "end_pos": 292, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "292", "site_seq": "N", "site_lbl": "Asn292", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 292, "end_pos": 292, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "292", "site_seq": "LQLTWLENGnVSR", "site_lbl": "Asn292", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 292, "end_pos": 292, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "292", "site_seq": "N", "site_lbl": "Asn292", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 292, "end_pos": 292, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "292", "site_seq": "LQLTWLENGnVSR", "site_lbl": "Asn292", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P78324-1", "start_pos": 292, "end_pos": 292, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "650", "url": "https://glyconnect.expasy.org/browser/proteins/650" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 504, "chemical_mass": 54967.0 } ] }, { "start_pos": "1020", "site_seq": "N", "site_lbl": "Asn1020", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "1020", "site_seq": "KPTVnLTTVLIGR", "site_lbl": "Asn1020", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "1020", "site_seq": "N", "site_lbl": "Asn1020", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "1020", "site_seq": "KPTVnLTTVLIGR", "site_lbl": "Asn1020", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "1020", "site_seq": "N", "site_lbl": "Asn1020", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "1020", "site_seq": "KPTVnLTTVLIGR", "site_lbl": "Asn1020", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "1020", "site_seq": "", "site_lbl": "N1020", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "4", "chr_pos": "89936740", "evidence": [ { "id": "rs1275553407", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1275553407" }, { "id": "rs1275553407", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1275553407" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "1020", "site_seq": "N", "site_lbl": "Asn1020", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "1020", "site_seq": "KPTVnLTTVLIGR", "site_lbl": "Asn1020", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "1020", "site_seq": "", "site_lbl": "N1020", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "4", "chr_pos": "89936740", "evidence": [ { "id": "rs1275553407", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1275553407" }, { "id": "rs1275553407", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1275553407" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13201-1", "start_pos": 1020, "end_pos": 1020, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" }, { "database": "GlyConnect", "id": "668", "url": "https://glyconnect.expasy.org/browser/proteins/668" } ], "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1228, "chemical_mass": 138110.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01859-2", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "688", "url": "https://glyconnect.expasy.org/browser/proteins/688" } ], "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 43806.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01859-2", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "688", "url": "https://glyconnect.expasy.org/browser/proteins/688" } ], "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 43806.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01859-2", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "688", "url": "https://glyconnect.expasy.org/browser/proteins/688" } ], "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 43806.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "14", "chr_pos": "105643755", "evidence": [ { "id": "rs1172977375", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172977375" }, { "id": "rs1172977375", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172977375" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "14", "chr_pos": "105643753", "evidence": [ { "id": "rs1411068751", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411068751" }, { "id": "rs1411068751", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411068751#frequency_tab" }, { "id": "rs1411068751", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411068751" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "105643754", "evidence": [ { "id": "rs2087481484", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2087481484" }, { "id": "rs2087481484", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2087481484" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01859-2", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "688", "url": "https://glyconnect.expasy.org/browser/proteins/688" } ], "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 43806.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01859-2", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "688", "url": "https://glyconnect.expasy.org/browser/proteins/688" } ], "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 43806.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "14", "chr_pos": "105643755", "evidence": [ { "id": "rs1172977375", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172977375" }, { "id": "rs1172977375", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172977375" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "14", "chr_pos": "105643753", "evidence": [ { "id": "rs1411068751", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411068751" }, { "id": "rs1411068751", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411068751#frequency_tab" }, { "id": "rs1411068751", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411068751" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "105643754", "evidence": [ { "id": "rs2087481484", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2087481484" }, { "id": "rs2087481484", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2087481484" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01859-2", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" }, { "database": "GlyConnect", "id": "688", "url": "https://glyconnect.expasy.org/browser/proteins/688" } ], "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 43806.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "SIVYSCEWPLYMWPFQKPnYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "PNYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "SIVYSCEWPLYMWPFQKPnYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "PNYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "SIVYSCEWPLYMWPFQKPnYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "PNYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "N", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "SIVYSCEWPLYMWPFQKPnYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "215", "site_seq": "PNYTEIR", "site_lbl": "Asn215", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P06280-1", "start_pos": 215, "end_pos": 215, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1005", "url": "https://glyconnect.expasy.org/browser/proteins/1005" } ], "protein_name": "Alpha-galactosidase A", "gene_name": "GLA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 429, "chemical_mass": 48767.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "11", "chr_pos": "1754946", "evidence": [ { "id": "rs1845791989", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1845791989" }, { "id": "rs1845791989", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1845791989" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "1754945", "evidence": [ { "id": "rs1248669413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248669413" }, { "id": "rs1248669413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248669413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "N", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLNVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "YYKGSLSYLnVTR", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "GSLSYLnVTRK", "site_lbl": "Asn263", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "263", "site_seq": "", "site_lbl": "N263", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "11", "chr_pos": "1754946", "evidence": [ { "id": "rs1845791989", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1845791989" }, { "id": "rs1845791989", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1845791989" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "1754945", "evidence": [ { "id": "rs1248669413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248669413" }, { "id": "rs1248669413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1248669413" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07339-1", "start_pos": 263, "end_pos": 263, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1079", "url": "https://glyconnect.expasy.org/browser/proteins/1079" } ], "protein_name": "Cathepsin D", "gene_name": "CTSD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 412, "chemical_mass": 44552.0 } ] }, { "start_pos": "400", "site_seq": "N", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "YHnQTLR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "YHNQTLR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "N", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "YHnQTLR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "YHNQTLR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "N", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "YHnQTLR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "YHNQTLR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "", "site_lbl": "N400", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "6", "chr_pos": "160033094", "evidence": [ { "id": "rs546763515", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546763515" }, { "id": "rs546763515", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs546763515" }, { "id": "rs546763515", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546763515" }, { "id": "rs546763515", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs546763515" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "6", "chr_pos": "160033095", "evidence": [ { "id": "rs560576091", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs560576091" }, { "id": "rs560576091", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs560576091" }, { "id": "rs560576091", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs560576091" }, { "id": "rs560576091", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs560576091#frequency_tab" }, { "id": "rs560576091", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs560576091" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "N", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "YHnQTLR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "YHNQTLR", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "400", "site_seq": "", "site_lbl": "N400", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "6", "chr_pos": "160033094", "evidence": [ { "id": "rs546763515", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546763515" }, { "id": "rs546763515", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs546763515" }, { "id": "rs546763515", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546763515" }, { "id": "rs546763515", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs546763515" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "6", "chr_pos": "160033095", "evidence": [ { "id": "rs560576091", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs560576091" }, { "id": "rs560576091", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs560576091" }, { "id": "rs560576091", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs560576091" }, { "id": "rs560576091", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs560576091#frequency_tab" }, { "id": "rs560576091", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs560576091" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1084", "url": "https://glyconnect.expasy.org/browser/proteins/1084" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVNLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVNLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVNLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "N", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVnLTWADLEDR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "19", "site_seq": "LWLPVNLTWADLEDRDGR", "site_lbl": "Asn19", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96G23-1", "start_pos": 19, "end_pos": 19, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1105", "url": "https://glyconnect.expasy.org/browser/proteins/1105" } ], "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 380, "chemical_mass": 44876.0 } ] }, { "start_pos": "18", "site_seq": "N", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "FWLPHnVTWADLK", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "FWLPHNVTWADLK", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "N", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "FWLPHnVTWADLK", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "FWLPHNVTWADLK", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "N", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "FWLPHnVTWADLK", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "FWLPHNVTWADLK", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "", "site_lbl": "N18", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "2", "chr_pos": "168456500", "evidence": [ { "id": "rs1224345601", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1224345601" }, { "id": "rs1224345601", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1224345601#frequency_tab" }, { "id": "rs1224345601", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1224345601" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "2", "chr_pos": "168456501", "evidence": [ { "id": "rs769616429", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769616429" }, { "id": "rs769616429", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769616429" }, { "id": "rs769616429", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769616429#frequency_tab" }, { "id": "rs769616429", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769616429" }, { "id": "rs769616429", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs769616429" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "N", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "FWLPHnVTWADLK", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "FWLPHNVTWADLK", "site_lbl": "Asn18", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "18", "site_seq": "", "site_lbl": "N18", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "2", "chr_pos": "168456500", "evidence": [ { "id": "rs1224345601", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1224345601" }, { "id": "rs1224345601", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1224345601#frequency_tab" }, { "id": "rs1224345601", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1224345601" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "2", "chr_pos": "168456501", "evidence": [ { "id": "rs769616429", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769616429" }, { "id": "rs769616429", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769616429" }, { "id": "rs769616429", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769616429#frequency_tab" }, { "id": "rs769616429", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769616429" }, { "id": "rs769616429", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs769616429" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6ZMG9-1", "start_pos": 18, "end_pos": 18, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1107", "url": "https://glyconnect.expasy.org/browser/proteins/1107" } ], "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 384, "chemical_mass": 44890.0 } ] }, { "start_pos": "1763", "site_seq": "N", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYnATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYNATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "N", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYnATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYNATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "N", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYnATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYNATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "", "site_lbl": "N1763", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "6", "chr_pos": "75137543", "evidence": [ { "id": "rs755536829", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755536829" }, { "id": "rs755536829", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755536829" }, { "id": "rs755536829", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755536829#frequency_tab" }, { "id": "rs755536829", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755536829" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "N", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYnATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "NLQVYNATSNSLTVK", "site_lbl": "Asn1763", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "1763", "site_seq": "", "site_lbl": "N1763", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "6", "chr_pos": "75137543", "evidence": [ { "id": "rs755536829", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755536829" }, { "id": "rs755536829", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755536829" }, { "id": "rs755536829", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755536829#frequency_tab" }, { "id": "rs755536829", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755536829" } ], "disease": [ { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] }, { "disease_id": "DOID:0060948", "name": "Ullrich congenital muscular dystrophy 2", "description": "An Ullrich congenital muscular dystrophy characterized by joint hypermobility, proximal contractures, and muscle weakness precluding ambulation that has_material_basis_in homozygous mutation in the COL12A1 gene on chromosome 6q.", "url": "http://disease-ontology.org/term/DOID:0060948", "evidence": [ { "id": "616470", "database": "MIM", "url": "https://www.omim.org/entry/616470" }, { "id": "0060948", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060948" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99715-1", "start_pos": 1763, "end_pos": 1763, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1131", "url": "https://glyconnect.expasy.org/browser/proteins/1131" } ], "protein_name": "Collagen alpha-1(XII) chain", "gene_name": "COL12A1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3063, "chemical_mass": 333147.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "88312517", "evidence": [ { "id": "rs576632189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576632189" }, { "id": "rs576632189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576632189" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "N", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCnETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "VTTYCNETMTGWVHDVLGR", "site_lbl": "Asn119", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "119", "site_seq": "", "site_lbl": "N119", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "88312517", "evidence": [ { "id": "rs576632189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576632189" }, { "id": "rs576632189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576632189" }, { "id": "rs576632189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576632189" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P53634-1", "start_pos": 119, "end_pos": 119, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1175", "url": "https://glyconnect.expasy.org/browser/proteins/1175" } ], "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 463, "chemical_mass": 51854.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "", "site_lbl": "N62", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "12", "chr_pos": "103932308", "evidence": [ { "id": "P14625", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P14625" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "N", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "TDDEVVQREEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLnASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "EEEAIQLDGLNASQIR", "site_lbl": "Asn62", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "62", "site_seq": "", "site_lbl": "N62", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAS->HAS).", "chr_id": "12", "chr_pos": "103932308", "evidence": [ { "id": "P14625", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P14625" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P14625-1", "start_pos": 62, "end_pos": 62, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1206", "url": "https://glyconnect.expasy.org/browser/proteins/1206" } ], "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 803, "chemical_mass": 92469.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "nCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CDSGFALDSEERnCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CRCDSGFALDSEERNCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "nCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CDSGFALDSEERnCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CRCDSGFALDSEERNCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "nCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CDSGFALDSEERnCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CRCDSGFALDSEERNCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "N1067", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "15", "chr_pos": "48488377", "evidence": [ { "id": "P35555", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P35555" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "15", "chr_pos": "48488375", "evidence": [ { "id": "rs1358163754", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1358163754" }, { "id": "rs1358163754", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1358163754" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->YCT).", "chr_id": "15", "chr_pos": "48488377", "evidence": [ { "id": "rs765043727", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765043727" }, { "id": "rs765043727", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765043727" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "N", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "nCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CDSGFALDSEERnCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "CRCDSGFALDSEERNCTDIDECR", "site_lbl": "Asn1067", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1067", "site_seq": "", "site_lbl": "N1067", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "15", "chr_pos": "48488377", "evidence": [ { "id": "P35555", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P35555" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "15", "chr_pos": "48488375", "evidence": [ { "id": "rs1358163754", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1358163754" }, { "id": "rs1358163754", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1358163754" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->YCT).", "chr_id": "15", "chr_pos": "48488377", "evidence": [ { "id": "rs765043727", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765043727" }, { "id": "rs765043727", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765043727" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35555-1", "start_pos": 1067, "end_pos": 1067, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1235", "url": "https://glyconnect.expasy.org/browser/proteins/1235" } ], "protein_name": "Fibrillin-1", "gene_name": "FBN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2871, "chemical_mass": 312298.0 } ] }, { "start_pos": "1112", "site_seq": "N", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "NCTDIDECR", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "N", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "NCTDIDECR", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "N", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "NCTDIDECR", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "", "site_lbl": "N1112", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "5", "chr_pos": "128344393", "evidence": [ { "id": "P35556", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P35556" }, { "id": "rs1301097230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301097230" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] }, { "disease_id": "DOID:0111595", "name": "congenital contractural arachnodactyly", "description": "A distal arthrogryposis characterized by contractures, arachnodactyly, scoliosis, and crumpled ears that has_material_basis_in heterozygous mutation in the FBN2 gene on chromosome 5q23.3.", "url": "http://disease-ontology.org/term/DOID:0111595", "evidence": [ { "id": "121050", "database": "MIM", "url": "https://www.omim.org/entry/121050" }, { "id": "0111595", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111595" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->TCT).", "chr_id": "5", "chr_pos": "128344393", "evidence": [ { "id": "rs1301097230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301097230" }, { "id": "rs1301097230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1301097230" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "N", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "NCTDIDECR", "site_lbl": "Asn1112", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1112", "site_seq": "", "site_lbl": "N1112", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "5", "chr_pos": "128344393", "evidence": [ { "id": "P35556", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P35556" }, { "id": "rs1301097230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301097230" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] }, { "disease_id": "DOID:0111595", "name": "congenital contractural arachnodactyly", "description": "A distal arthrogryposis characterized by contractures, arachnodactyly, scoliosis, and crumpled ears that has_material_basis_in heterozygous mutation in the FBN2 gene on chromosome 5q23.3.", "url": "http://disease-ontology.org/term/DOID:0111595", "evidence": [ { "id": "121050", "database": "MIM", "url": "https://www.omim.org/entry/121050" }, { "id": "0111595", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111595" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->TCT).", "chr_id": "5", "chr_pos": "128344393", "evidence": [ { "id": "rs1301097230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301097230" }, { "id": "rs1301097230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1301097230" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P35556-1", "start_pos": 1112, "end_pos": 1112, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1236", "url": "https://glyconnect.expasy.org/browser/proteins/1236" } ], "protein_name": "Fibrillin-2", "gene_name": "FBN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2912, "chemical_mass": 314775.0 } ] }, { "start_pos": "1025", "site_seq": "N", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "VFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECR", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "N", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "VFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECR", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "N", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "VFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECR", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "", "site_lbl": "N1025", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "19", "chr_pos": "8123473", "evidence": [ { "id": "rs1725454320", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1725454320" }, { "id": "rs1725454320", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1725454320" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "19", "chr_pos": "8123471", "evidence": [ { "id": "rs2082902690", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2082902690" }, { "id": "rs2082902690", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2082902690#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->TCT).", "chr_id": "19", "chr_pos": "8123472", "evidence": [ { "id": "rs765206008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765206008" }, { "id": "rs765206008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765206008" }, { "id": "rs765206008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765206008" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "N", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "VFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDIDECR", "site_lbl": "Asn1025", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "1025", "site_seq": "", "site_lbl": "N1025", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "19", "chr_pos": "8123473", "evidence": [ { "id": "rs1725454320", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1725454320" }, { "id": "rs1725454320", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1725454320" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "19", "chr_pos": "8123471", "evidence": [ { "id": "rs2082902690", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2082902690" }, { "id": "rs2082902690", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2082902690#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->TCT).", "chr_id": "19", "chr_pos": "8123472", "evidence": [ { "id": "rs765206008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765206008" }, { "id": "rs765206008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765206008" }, { "id": "rs765206008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765206008" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q75N90-1", "start_pos": 1025, "end_pos": 1025, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1237", "url": "https://glyconnect.expasy.org/browser/proteins/1237" } ], "protein_name": "Fibrillin-3", "gene_name": "FBN3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2809, "chemical_mass": 300356.0 } ] }, { "start_pos": "203", "site_seq": "N", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "203", "site_seq": "nFTMNEK", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "ALIYQFSPIYTGnISSFQQCYIFD", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "ALIYQFSPIYTGNISSFQQCYIFD", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "203", "site_seq": "N", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "203", "site_seq": "nFTMNEK", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "ALIYQFSPIYTGnISSFQQCYIFD", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "ALIYQFSPIYTGNISSFQQCYIFD", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "203", "site_seq": "N", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "203", "site_seq": "nFTMNEK", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "ALIYQFSPIYTGnISSFQQCYIFD", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "ALIYQFSPIYTGNISSFQQCYIFD", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "203", "site_seq": "N", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "203", "site_seq": "nFTMNEK", "site_lbl": "Asn203", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 203, "end_pos": 203, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "N", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "ALIYQFSPIYTGnISSFQQCYIFD", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "307", "site_seq": "ALIYQFSPIYTGNISSFQQCYIFD", "site_lbl": "Asn307", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92820-1", "start_pos": 307, "end_pos": 307, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1257", "url": "https://glyconnect.expasy.org/browser/proteins/1257" } ], "protein_name": "Gamma-glutamyl hydrolase", "gene_name": "GGH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 318, "chemical_mass": 35964.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVnVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVNVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVnVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVNVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVnVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVNVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "", "site_lbl": "N63", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "19", "chr_pos": "18175095", "evidence": [ { "id": "rs1190449225", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1190449225" }, { "id": "rs1190449225", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1190449225#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "N", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVnVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "SNAPLVNVTLYYEALCGGCR", "site_lbl": "Asn63", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "63", "site_seq": "", "site_lbl": "N63", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "19", "chr_pos": "18175095", "evidence": [ { "id": "rs1190449225", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1190449225" }, { "id": "rs1190449225", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1190449225#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13284-1", "start_pos": 63, "end_pos": 63, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1262", "url": "https://glyconnect.expasy.org/browser/proteins/1262" } ], "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 250, "chemical_mass": 27964.0 } ] }, { "start_pos": "515", "site_seq": "N", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "VFGSQnLTTVK", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "N", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "VInETWAWK", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "nATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "NATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLnASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "N", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "VFGSQnLTTVK", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "N", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "VInETWAWK", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "nATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "NATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLnASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "N", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "VFGSQnLTTVK", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "N", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "VInETWAWK", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "nATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "NATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLnASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "", "site_lbl": "N862", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->DET).", "chr_id": "11", "chr_pos": "119047745", "evidence": [ { "id": "rs1944168165", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1944168165" }, { "id": "rs1944168165", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1944168165" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "119047744", "evidence": [ { "id": "rs534349629", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534349629" }, { "id": "rs534349629", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs534349629" }, { "id": "rs534349629", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs534349629#frequency_tab" }, { "id": "rs2133557957", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133557957" }, { "id": "rs2133557957", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2133557957" }, { "id": "rs2133557957", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133557957" }, { "id": "rs2133557957", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133557957" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "", "site_lbl": "N931", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "11", "chr_pos": "119046605", "evidence": [ { "id": "rs1317070841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1317070841" }, { "id": "rs1317070841", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1317070841#frequency_tab" }, { "id": "rs2133551387", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551387" }, { "id": "rs2133551387", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551387" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "11", "chr_pos": "119046606", "evidence": [ { "id": "rs782171221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782171221" }, { "id": "rs782171221", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782171221#frequency_tab" }, { "id": "rs782171221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782171221" }, { "id": "rs2133551439", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551439" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "N", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "515", "site_seq": "VFGSQnLTTVK", "site_lbl": "Asn515", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 515, "end_pos": 515, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "N", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "VInETWAWK", "site_lbl": "Asn862", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "N", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "nATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "869", "site_seq": "NATLAEQAK", "site_lbl": "Asn869", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 869, "end_pos": 869, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLnASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASASDQGEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "862", "site_seq": "", "site_lbl": "N862", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->DET).", "chr_id": "11", "chr_pos": "119047745", "evidence": [ { "id": "rs1944168165", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1944168165" }, { "id": "rs1944168165", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1944168165" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "11", "chr_pos": "119047744", "evidence": [ { "id": "rs534349629", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534349629" }, { "id": "rs534349629", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs534349629" }, { "id": "rs534349629", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs534349629#frequency_tab" }, { "id": "rs2133557957", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133557957" }, { "id": "rs2133557957", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2133557957" }, { "id": "rs2133557957", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133557957" }, { "id": "rs2133557957", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133557957" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 862, "end_pos": 862, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "931", "site_seq": "", "site_lbl": "N931", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->KAS).", "chr_id": "11", "chr_pos": "119046605", "evidence": [ { "id": "rs1317070841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1317070841" }, { "id": "rs1317070841", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1317070841#frequency_tab" }, { "id": "rs2133551387", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551387" }, { "id": "rs2133551387", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551387" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "11", "chr_pos": "119046606", "evidence": [ { "id": "rs782171221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782171221" }, { "id": "rs782171221", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782171221#frequency_tab" }, { "id": "rs782171221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782171221" }, { "id": "rs2133551439", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133551439" }, { "id": "rs2133551439", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2133551439" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4L1-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1383", "url": "https://glyconnect.expasy.org/browser/proteins/1383" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 999, "chemical_mass": 111335.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "LRNPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQNCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "LRNPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQNCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "LRNPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQNCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "LRNPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQnCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "212", "site_seq": "NPCTSEQNCTSPFSYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "1366", "site_seq": "N", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "FYFGGSPISAQYAnFTGCISNAYFTR", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "KFYFGGSPISAQYANFTGCISNAYFTR", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "N", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "FYFGGSPISAQYAnFTGCISNAYFTR", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "KFYFGGSPISAQYANFTGCISNAYFTR", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "N", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "FYFGGSPISAQYAnFTGCISNAYFTR", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "KFYFGGSPISAQYANFTGCISNAYFTR", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "N", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "FYFGGSPISAQYAnFTGCISNAYFTR", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1366", "site_seq": "KFYFGGSPISAQYANFTGCISNAYFTR", "site_lbl": "Asn1366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1366, "end_pos": 1366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1440", "url": "https://glyconnect.expasy.org/browser/proteins/1440" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "421", "site_seq": "N", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1448", "url": "https://glyconnect.expasy.org/browser/proteins/1448" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "DECWCPAnSTGK", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1448", "url": "https://glyconnect.expasy.org/browser/proteins/1448" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "N", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1448", "url": "https://glyconnect.expasy.org/browser/proteins/1448" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "DECWCPAnSTGK", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1448", "url": "https://glyconnect.expasy.org/browser/proteins/1448" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "N", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1448", "url": "https://glyconnect.expasy.org/browser/proteins/1448" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "DECWCPAnSTGK", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1448", "url": "https://glyconnect.expasy.org/browser/proteins/1448" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "", "site_lbl": "N421", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "14", "chr_pos": "74552325", "evidence": [ { "id": "rs2087671361", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2087671361" }, { "id": "rs2087671361", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2087671361#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "14", "chr_pos": "74552323", "evidence": [ { "id": "Q14767", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14767" }, { "id": "rs746580964", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746580964" }, { "id": "rs746580964", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746580964" }, { "id": "rs746580964", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746580964" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "74552324", "evidence": [ { "id": "rs1194656181", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1194656181" }, { "id": "rs1194656181", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1194656181" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1448", "url": "https://glyconnect.expasy.org/browser/proteins/1448" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "N", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1448", "url": "https://glyconnect.expasy.org/browser/proteins/1448" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "DECWCPAnSTGK", "site_lbl": "Asn421", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1448", "url": "https://glyconnect.expasy.org/browser/proteins/1448" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "421", "site_seq": "", "site_lbl": "N421", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "14", "chr_pos": "74552325", "evidence": [ { "id": "rs2087671361", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2087671361" }, { "id": "rs2087671361", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2087671361#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "14", "chr_pos": "74552323", "evidence": [ { "id": "Q14767", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14767" }, { "id": "rs746580964", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746580964" }, { "id": "rs746580964", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746580964" }, { "id": "rs746580964", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746580964" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "14", "chr_pos": "74552324", "evidence": [ { "id": "rs1194656181", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1194656181" }, { "id": "rs1194656181", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1194656181" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14767-1", "start_pos": 421, "end_pos": 421, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1448", "url": "https://glyconnect.expasy.org/browser/proteins/1448" } ], "protein_name": "Latent-transforming growth factor beta-binding protein 2", "gene_name": "LTBP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1821, "chemical_mass": 195052.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "", "site_lbl": "N122", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "19", "chr_pos": "19219206", "evidence": [ { "id": "O14594", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O14594" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "ANATLLLGPLR", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "122", "site_seq": "", "site_lbl": "N122", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "19", "chr_pos": "19219206", "evidence": [ { "id": "O14594", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O14594" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O14594-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1550", "url": "https://glyconnect.expasy.org/browser/proteins/1550" } ], "protein_name": "Neurocan core protein", "gene_name": "NCAN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1321, "chemical_mass": 143093.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "EDVYRnHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "nHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "NHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GInESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GINESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GInESYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "EDVYRnHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "nHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "NHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GInESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GINESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GInESYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "EDVYRnHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "nHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "NHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GInESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GINESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GInESYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->IHS).", "chr_id": "1", "chr_pos": "40089443", "evidence": [ { "id": "rs1243682841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1243682841" }, { "id": "rs1243682841", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1243682841" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "1", "chr_pos": "40089443", "evidence": [ { "id": "rs1243682841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1243682841" }, { "id": "rs1243682841", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1243682841" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "", "site_lbl": "N212", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->DES).", "chr_id": "1", "chr_pos": "40078652", "evidence": [ { "id": "rs375831846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375831846#frequency_tab" }, { "id": "rs375831846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375831846" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->SES).", "chr_id": "1", "chr_pos": "40078651", "evidence": [ { "id": "rs568730410", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs568730410" }, { "id": "rs568730410", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs568730410" }, { "id": "rs568730410", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs568730410" }, { "id": "rs568730410", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs568730410#frequency_tab" }, { "id": "rs568730410", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs568730410" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->YES).", "chr_id": "1", "chr_pos": "40078652", "evidence": [ { "id": "rs375831846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375831846#frequency_tab" }, { "id": "rs375831846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375831846" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "N", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "EDVYRnHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "nHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "NHSIFLADINQER", "site_lbl": "Asn197", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "N", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GInESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GINESYKK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "GInESYK", "site_lbl": "Asn212", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "197", "site_seq": "", "site_lbl": "N197", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->IHS).", "chr_id": "1", "chr_pos": "40089443", "evidence": [ { "id": "rs1243682841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1243682841" }, { "id": "rs1243682841", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1243682841" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->SHS).", "chr_id": "1", "chr_pos": "40089443", "evidence": [ { "id": "rs1243682841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1243682841" }, { "id": "rs1243682841", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1243682841" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 197, "end_pos": 197, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "212", "site_seq": "", "site_lbl": "N212", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->DES).", "chr_id": "1", "chr_pos": "40078652", "evidence": [ { "id": "rs375831846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375831846#frequency_tab" }, { "id": "rs375831846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375831846" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->SES).", "chr_id": "1", "chr_pos": "40078651", "evidence": [ { "id": "rs568730410", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs568730410" }, { "id": "rs568730410", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs568730410" }, { "id": "rs568730410", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs568730410" }, { "id": "rs568730410", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs568730410#frequency_tab" }, { "id": "rs568730410", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs568730410" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->YES).", "chr_id": "1", "chr_pos": "40078652", "evidence": [ { "id": "rs375831846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375831846" }, { "id": "rs375831846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375831846#frequency_tab" }, { "id": "rs375831846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375831846" } ], "disease": [ { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:0110721", "name": "neuronal ceroid lipofuscinosis 1", "description": "A neuronal ceroid lipofuscinosis that is characterized by variable age of onset of symptoms (progressive dementia, seizures, and progressive visual failure) and lipopigment pattern of granular osmiophilic deposits, and has_material_basis_in homozygous or compound heterozygous mutation in the PPT1 gene on chromosome 1p34.", "url": "http://disease-ontology.org/term/DOID:0110721", "evidence": [ { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" }, { "id": "0110721", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110721" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] }, { "disease_id": "DOID:14503", "name": "neuronal ceroid lipofuscinosis", "description": "", "url": "http://disease-ontology.org/term/DOID:14503", "evidence": [ { "id": "14503", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14503" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50897-1", "start_pos": 212, "end_pos": 212, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1592", "url": "https://glyconnect.expasy.org/browser/proteins/1592" } ], "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "PPT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 306, "chemical_mass": 34193.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "LLHALGGDDFLGMLnR", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "LLHALGGDDFLGMLnR", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "LLHALGGDDFLGMLnR", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "", "site_lbl": "N196", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->HRT).", "chr_id": "2", "chr_pos": "70275050", "evidence": [ { "id": "rs1474272261", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474272261" }, { "id": "rs1474272261", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1474272261#frequency_tab" }, { "id": "rs1474272261", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474272261" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->YRT).", "chr_id": "2", "chr_pos": "70275050", "evidence": [ { "id": "rs1474272261", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474272261" }, { "id": "rs1474272261", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1474272261#frequency_tab" }, { "id": "rs1474272261", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474272261" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "N", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "LLHALGGDDFLGMLnR", "site_lbl": "Asn196", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "196", "site_seq": "", "site_lbl": "N196", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->HRT).", "chr_id": "2", "chr_pos": "70275050", "evidence": [ { "id": "rs1474272261", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474272261" }, { "id": "rs1474272261", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1474272261#frequency_tab" }, { "id": "rs1474272261", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474272261" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->YRT).", "chr_id": "2", "chr_pos": "70275050", "evidence": [ { "id": "rs1474272261", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474272261" }, { "id": "rs1474272261", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1474272261#frequency_tab" }, { "id": "rs1474272261", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474272261" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UHG3-1", "start_pos": 196, "end_pos": 196, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1624", "url": "https://glyconnect.expasy.org/browser/proteins/1624" } ], "protein_name": "Prenylcysteine oxidase 1", "gene_name": "PCYOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 505, "chemical_mass": 56640.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnKTEK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "426", "site_seq": "N", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "426", "site_seq": "NLEKnSTK", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnKTEK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "426", "site_seq": "N", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "426", "site_seq": "NLEKnSTK", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnKTEK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "426", "site_seq": "N", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "426", "site_seq": "NLEKnSTK", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "", "site_lbl": "N332", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "10", "chr_pos": "71820249", "evidence": [ { "id": "rs546727182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546727182" }, { "id": "rs546727182", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs546727182" }, { "id": "rs546727182", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546727182" }, { "id": "rs546727182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs546727182#frequency_tab" }, { "id": "rs546727182", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs546727182" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->nullKT).", "chr_id": "10", "chr_pos": "71820248TGT", "evidence": [ { "id": "rs751974432", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751974432" } ], "disease": [ { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "N", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "LIDNnKTEK", "site_lbl": "Asn332", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "426", "site_seq": "N", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "426", "site_seq": "NLEKnSTK", "site_lbl": "Asn426", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 426, "end_pos": 426, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "332", "site_seq": "", "site_lbl": "N332", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "10", "chr_pos": "71820249", "evidence": [ { "id": "rs546727182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546727182" }, { "id": "rs546727182", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs546727182" }, { "id": "rs546727182", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546727182" }, { "id": "rs546727182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs546727182#frequency_tab" }, { "id": "rs546727182", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs546727182" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->nullKT).", "chr_id": "10", "chr_pos": "71820248TGT", "evidence": [ { "id": "rs751974432", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751974432" } ], "disease": [ { "disease_id": "DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system.", "url": "http://disease-ontology.org/term/DOID:10581", "evidence": [ { "id": "10581", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10581" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07602-1", "start_pos": 332, "end_pos": 332, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "protein_name": "Prosaposin", "gene_name": "PSAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 524, "chemical_mass": 58113.0 } ] }, { "start_pos": "1608", "site_seq": "N", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "TLETHSnK", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "TLETHSNKTNTVLK", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "N", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "TLETHSnK", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "TLETHSNKTNTVLK", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "N", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "TLETHSnK", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "TLETHSNKTNTVLK", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "N", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "TLETHSnK", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1608", "site_seq": "TLETHSNKTNTVLK", "site_lbl": "Asn1608", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1608, "end_pos": 1608, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1766", "url": "https://glyconnect.expasy.org/browser/proteins/1766" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "130", "site_seq": "N", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "nGSGAVFPVAGADVQTLR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "NGSGAVFPVAGADVQTLR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "N", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "nGSGAVFPVAGADVQTLR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "NGSGAVFPVAGADVQTLR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "N", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "nGSGAVFPVAGADVQTLR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "NGSGAVFPVAGADVQTLR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "", "site_lbl": "N130", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "1", "chr_pos": "180175342", "evidence": [ { "id": "O00391", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O00391" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "1", "chr_pos": "180175343", "evidence": [ { "id": "rs1662863114", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1662863114" }, { "id": "rs1662863114", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1662863114#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "N", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "nGSGAVFPVAGADVQTLR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "NGSGAVFPVAGADVQTLR", "site_lbl": "Asn130", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "", "site_lbl": "N130", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "1", "chr_pos": "180175342", "evidence": [ { "id": "O00391", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O00391" } ], "disease": [ { "disease_id": "DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver.", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "1", "chr_pos": "180175343", "evidence": [ { "id": "rs1662863114", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1662863114" }, { "id": "rs1662863114", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1662863114#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "130", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation site.", "evidence": [ { "database": "UniProtKB", "id": "O00391", "url": "https://www.uniprot.org/uniprotkb/O00391" }, { "database": "PubMed", "id": "29757379", "url": "https://glygen.org/publication/PubMed/29757379" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00391-1", "start_pos": 130, "end_pos": 130, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1774", "url": "https://glyconnect.expasy.org/browser/proteins/1774" } ], "protein_name": "Sulfhydryl oxidase 1", "gene_name": "QSOX1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 747, "chemical_mass": 82578.0 } ] }, { "start_pos": "1018", "site_seq": "N", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "LnYSLPTGQWVGVQLPR", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "YRLnYSLPTGQWVGVQLPR", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "N", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "LnYSLPTGQWVGVQLPR", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "YRLnYSLPTGQWVGVQLPR", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "N", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "LnYSLPTGQWVGVQLPR", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "YRLnYSLPTGQWVGVQLPR", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "", "site_lbl": "N1018", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "9", "chr_pos": "115073765", "evidence": [ { "id": "rs1418731906", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1418731906" }, { "id": "rs1418731906", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1418731906#frequency_tab" }, { "id": "rs1418731906", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1418731906" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "9", "chr_pos": "115073764", "evidence": [ { "id": "P24821", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P24821" }, { "id": "rs61729548", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61729548" }, { "id": "rs61729548", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61729548#frequency_tab" }, { "id": "rs61729548", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61729548" }, { "id": "rs61729548", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61729548" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->YYS).", "chr_id": "9", "chr_pos": "115073765", "evidence": [ { "id": "rs1418731906", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1418731906" }, { "id": "rs1418731906", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1418731906#frequency_tab" }, { "id": "rs1418731906", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1418731906" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "N", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "LnYSLPTGQWVGVQLPR", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "YRLnYSLPTGQWVGVQLPR", "site_lbl": "Asn1018", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "1018", "site_seq": "", "site_lbl": "N1018", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "9", "chr_pos": "115073765", "evidence": [ { "id": "rs1418731906", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1418731906" }, { "id": "rs1418731906", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1418731906#frequency_tab" }, { "id": "rs1418731906", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1418731906" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->SYS).", "chr_id": "9", "chr_pos": "115073764", "evidence": [ { "id": "P24821", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P24821" }, { "id": "rs61729548", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61729548" }, { "id": "rs61729548", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61729548#frequency_tab" }, { "id": "rs61729548", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61729548" }, { "id": "rs61729548", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61729548" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->YYS).", "chr_id": "9", "chr_pos": "115073765", "evidence": [ { "id": "rs1418731906", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1418731906" }, { "id": "rs1418731906", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1418731906#frequency_tab" }, { "id": "rs1418731906", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1418731906" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P24821-1", "start_pos": 1018, "end_pos": 1018, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1792", "url": "https://glyconnect.expasy.org/browser/proteins/1792" } ], "protein_name": "Tenascin", "gene_name": "TNC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2201, "chemical_mass": 240853.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "NTTYQLGQSEYLNVLQPQQ", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "NTTYQLGQSEYLNVLQPQQ", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "NTTYQLGQSEYLNVLQPQQ", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "", "site_lbl": "N256", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "7", "chr_pos": "12231917", "evidence": [ { "id": "rs1782033094", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1782033094" }, { "id": "rs1782033094", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1782033094" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "N", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "NTTYQLGQSEYLNVLQPQQ", "site_lbl": "Asn256", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "256", "site_seq": "", "site_lbl": "N256", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "7", "chr_pos": "12231917", "evidence": [ { "id": "rs1782033094", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1782033094" }, { "id": "rs1782033094", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1782033094" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9NUM4-1", "start_pos": 256, "end_pos": 256, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1849", "url": "https://glyconnect.expasy.org/browser/proteins/1849" } ], "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 274, "chemical_mass": 31127.0 } ] }, { "start_pos": "575", "site_seq": "N", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "NVTHSGR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "nVTHSGR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "N", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "NVTHSGR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "nVTHSGR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "N", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "NVTHSGR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "nVTHSGR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "", "site_lbl": "N575", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "9", "chr_pos": "109057321", "evidence": [ { "id": "rs1828869914", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1828869914" }, { "id": "rs1828869914", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1828869914#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "N", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "NVTHSGR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "nVTHSGR", "site_lbl": "Asn575", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "575", "site_seq": "", "site_lbl": "N575", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "9", "chr_pos": "109057321", "evidence": [ { "id": "rs1828869914", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1828869914" }, { "id": "rs1828869914", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1828869914#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H330-2", "start_pos": 575, "end_pos": 575, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1853", "url": "https://glyconnect.expasy.org/browser/proteins/1853" } ], "protein_name": "Transmembrane protein 245", "gene_name": "TMEM245", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 879, "chemical_mass": 97357.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15661-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1861", "url": "https://glyconnect.expasy.org/browser/proteins/1861" } ], "protein_name": "Tryptase alpha/beta-1", "gene_name": "TPSAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30515.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15661-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1861", "url": "https://glyconnect.expasy.org/browser/proteins/1861" } ], "protein_name": "Tryptase alpha/beta-1", "gene_name": "TPSAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30515.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15661-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1861", "url": "https://glyconnect.expasy.org/browser/proteins/1861" } ], "protein_name": "Tryptase alpha/beta-1", "gene_name": "TPSAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30515.0 } ] }, { "start_pos": "233", "site_seq": "", "site_lbl": "N233", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "16", "chr_pos": "1242111", "evidence": [ { "id": "rs1567573948", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567573948" }, { "id": "rs1567573948", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567573948" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15661-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1861", "url": "https://glyconnect.expasy.org/browser/proteins/1861" } ], "protein_name": "Tryptase alpha/beta-1", "gene_name": "TPSAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30515.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15661-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1861", "url": "https://glyconnect.expasy.org/browser/proteins/1861" } ], "protein_name": "Tryptase alpha/beta-1", "gene_name": "TPSAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30515.0 } ] }, { "start_pos": "233", "site_seq": "", "site_lbl": "N233", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "16", "chr_pos": "1242111", "evidence": [ { "id": "rs1567573948", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567573948" }, { "id": "rs1567573948", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567573948" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15661-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1861", "url": "https://glyconnect.expasy.org/browser/proteins/1861" } ], "protein_name": "Tryptase alpha/beta-1", "gene_name": "TPSAB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30515.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20231-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1862", "url": "https://glyconnect.expasy.org/browser/proteins/1862" } ], "protein_name": "Tryptase beta-2", "gene_name": "TPSB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30651.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20231-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1862", "url": "https://glyconnect.expasy.org/browser/proteins/1862" } ], "protein_name": "Tryptase beta-2", "gene_name": "TPSB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30651.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20231-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1862", "url": "https://glyconnect.expasy.org/browser/proteins/1862" } ], "protein_name": "Tryptase beta-2", "gene_name": "TPSB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30651.0 } ] }, { "start_pos": "233", "site_seq": "", "site_lbl": "N233", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "16", "chr_pos": "1228780", "evidence": [ { "id": "rs1407090244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1407090244" }, { "id": "rs1407090244", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1407090244" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "16", "chr_pos": "1228780", "evidence": [ { "id": "rs1407090244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1407090244" }, { "id": "rs1407090244", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1407090244" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20231-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1862", "url": "https://glyconnect.expasy.org/browser/proteins/1862" } ], "protein_name": "Tryptase beta-2", "gene_name": "TPSB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30651.0 } ] }, { "start_pos": "233", "site_seq": "N", "site_lbl": "Asn233", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20231-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1862", "url": "https://glyconnect.expasy.org/browser/proteins/1862" } ], "protein_name": "Tryptase beta-2", "gene_name": "TPSB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30651.0 } ] }, { "start_pos": "233", "site_seq": "", "site_lbl": "N233", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "16", "chr_pos": "1228780", "evidence": [ { "id": "rs1407090244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1407090244" }, { "id": "rs1407090244", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1407090244" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "16", "chr_pos": "1228780", "evidence": [ { "id": "rs1407090244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1407090244" }, { "id": "rs1407090244", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1407090244" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P20231-1", "start_pos": 233, "end_pos": 233, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "1862", "url": "https://glyconnect.expasy.org/browser/proteins/1862" } ], "protein_name": "Tryptase beta-2", "gene_name": "TPSB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 275, "chemical_mass": 30651.0 } ] }, { "start_pos": "657", "site_seq": "N", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "LTGSDVNLLAENLLSPEDMVLFHnLTQPR", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "LTGSDVNLLAENLLSPEDMVLFHNLTQPR", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "N", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "LTGSDVNLLAENLLSPEDMVLFHnLTQPR", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "LTGSDVNLLAENLLSPEDMVLFHNLTQPR", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "N", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "LTGSDVNLLAENLLSPEDMVLFHnLTQPR", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "LTGSDVNLLAENLLSPEDMVLFHNLTQPR", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "", "site_lbl": "N657", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "19", "chr_pos": "11120217", "evidence": [ { "id": "rs1057519678", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1057519678" }, { "id": "rs1057519678", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1057519678" } ], "disease": [ { "disease_id": "DOID:13810", "name": "familial hypercholesterolemia", "description": "A familial hyperlipidemia characterized by very high levels of low-density lipoprotein (LDL) and early cardiovascular disease.", "url": "http://disease-ontology.org/term/DOID:13810", "evidence": [ { "id": "13810", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:13810" } ] }, { "disease_id": "DOID:13810", "name": "familial hypercholesterolemia", "description": "A familial hyperlipidemia characterized by very high levels of low-density lipoprotein (LDL) and early cardiovascular disease.", "url": "http://disease-ontology.org/term/DOID:13810", "evidence": [ { "id": "13810", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:13810" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "19", "chr_pos": "11120216", "evidence": [ { "id": "rs1600742798", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1600742798" } ], "disease": [ { "disease_id": "DOID:13810", "name": "familial hypercholesterolemia", "description": "A familial hyperlipidemia characterized by very high levels of low-density lipoprotein (LDL) and early cardiovascular disease.", "url": "http://disease-ontology.org/term/DOID:13810", "evidence": [ { "id": "13810", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:13810" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "19", "chr_pos": "11120216", "evidence": [ { "id": "rs1600742798", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1600742798" }, { "id": "rs1600742798", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1600742798" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "N", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "LTGSDVNLLAENLLSPEDMVLFHnLTQPR", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "LTGSDVNLLAENLLSPEDMVLFHNLTQPR", "site_lbl": "Asn657", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "657", "site_seq": "", "site_lbl": "N657", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "19", "chr_pos": "11120217", "evidence": [ { "id": "rs1057519678", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1057519678" }, { "id": "rs1057519678", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1057519678" } ], "disease": [ { "disease_id": "DOID:13810", "name": "familial hypercholesterolemia", "description": "A familial hyperlipidemia characterized by very high levels of low-density lipoprotein (LDL) and early cardiovascular disease.", "url": "http://disease-ontology.org/term/DOID:13810", "evidence": [ { "id": "13810", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:13810" } ] }, { "disease_id": "DOID:13810", "name": "familial hypercholesterolemia", "description": "A familial hyperlipidemia characterized by very high levels of low-density lipoprotein (LDL) and early cardiovascular disease.", "url": "http://disease-ontology.org/term/DOID:13810", "evidence": [ { "id": "13810", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:13810" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "19", "chr_pos": "11120216", "evidence": [ { "id": "rs1600742798", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1600742798" } ], "disease": [ { "disease_id": "DOID:13810", "name": "familial hypercholesterolemia", "description": "A familial hyperlipidemia characterized by very high levels of low-density lipoprotein (LDL) and early cardiovascular disease.", "url": "http://disease-ontology.org/term/DOID:13810", "evidence": [ { "id": "13810", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:13810" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "19", "chr_pos": "11120216", "evidence": [ { "id": "rs1600742798", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1600742798" }, { "id": "rs1600742798", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1600742798" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01130-1", "start_pos": 657, "end_pos": 657, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "343", "url": "https://glyconnect.expasy.org/browser/proteins/343" } ], "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 860, "chemical_mass": 95376.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "GHTLTLnFTR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "GHTLTLnFTR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "GHTLTLnFTR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "13", "chr_pos": "113309766", "evidence": [ { "id": "rs757261971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757261971" }, { "id": "rs757261971", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757261971" }, { "id": "rs757261971", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757261971#frequency_tab" }, { "id": "rs757261971", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757261971" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "13", "chr_pos": "113309767", "evidence": [ { "id": "rs2042619552", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2042619552" }, { "id": "rs2042619552", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2042619552" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "13", "chr_pos": "113319653", "evidence": [ { "id": "rs755576074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755576074#frequency_tab" }, { "id": "rs755576074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755576074" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "", "site_lbl": "N261", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "13", "chr_pos": "113320377", "evidence": [ { "id": "rs749315723", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749315723" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "13", "chr_pos": "113320376", "evidence": [ { "id": "rs1469959940", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469959940" }, { "id": "rs1469959940", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1469959940#frequency_tab" }, { "id": "rs1469959940", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1469959940" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "", "site_lbl": "N84", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->TTS).", "chr_id": "13", "chr_pos": "113309710", "evidence": [ { "id": "rs762446154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762446154#frequency_tab" }, { "id": "rs762446154", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762446154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "GHTLTLnFTR", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "N", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "DnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDnTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "KDNTTVTR", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPnK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "LLNINPNK", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "N", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "EnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKEnTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "SSCGKENTSDPSLVIAFGR", "site_lbl": "Asn84", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "N103", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "13", "chr_pos": "113309766", "evidence": [ { "id": "rs757261971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757261971" }, { "id": "rs757261971", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757261971" }, { "id": "rs757261971", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757261971#frequency_tab" }, { "id": "rs757261971", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757261971" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "13", "chr_pos": "113309767", "evidence": [ { "id": "rs2042619552", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2042619552" }, { "id": "rs2042619552", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2042619552" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "249", "site_seq": "", "site_lbl": "N249", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "13", "chr_pos": "113319653", "evidence": [ { "id": "rs755576074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755576074#frequency_tab" }, { "id": "rs755576074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755576074" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "261", "site_seq": "", "site_lbl": "N261", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "13", "chr_pos": "113320377", "evidence": [ { "id": "rs749315723", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749315723" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "13", "chr_pos": "113320376", "evidence": [ { "id": "rs1469959940", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469959940" }, { "id": "rs1469959940", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1469959940#frequency_tab" }, { "id": "rs1469959940", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1469959940" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "84", "site_seq": "", "site_lbl": "N84", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->TTS).", "chr_id": "13", "chr_pos": "113309710", "evidence": [ { "id": "rs762446154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762446154#frequency_tab" }, { "id": "rs762446154", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762446154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11279-1", "start_pos": 84, "end_pos": 84, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "LAMP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 417, "chemical_mass": 44882.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "", "site_lbl": "N356", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "X", "chr_pos": "120441756", "evidence": [ { "id": "rs775416221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775416221" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "N", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "VQPFnVTQGK", "site_lbl": "Asn356", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "356", "site_seq": "", "site_lbl": "N356", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "X", "chr_pos": "120441756", "evidence": [ { "id": "rs775416221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775416221" } ], "disease": [ { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] }, { "disease_id": "DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene.", "url": "http://disease-ontology.org/term/DOID:0050437", "evidence": [ { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" }, { "id": "0050437", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050437" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13473-1", "start_pos": 356, "end_pos": 356, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 410, "chemical_mass": 44961.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "LGIYADMGnFTCMGYPGTTLDK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "LGIYADMGnFTCMGYPGTTLDK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "LGIYADMGnFTCMGYPGTTLDK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "", "site_lbl": "N124", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "22", "chr_pos": "42067244", "evidence": [ { "id": "rs374661289", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374661289" }, { "id": "rs374661289", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374661289" }, { "id": "rs374661289", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374661289#frequency_tab" }, { "id": "rs374661289", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374661289" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "LGIYADMGnFTCMGYPGTTLDK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "124", "site_seq": "", "site_lbl": "N124", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "22", "chr_pos": "42067244", "evidence": [ { "id": "rs374661289", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374661289" }, { "id": "rs374661289", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374661289" }, { "id": "rs374661289", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374661289#frequency_tab" }, { "id": "rs374661289", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374661289" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17050-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "45", "url": "https://glyconnect.expasy.org/browser/proteins/45" } ], "protein_name": "Alpha-N-acetylgalactosaminidase", "gene_name": "NAGA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 46565.0 } ] }, { "start_pos": "1365", "site_seq": "N", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01266-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "protein_name": "Thyroglobulin", "gene_name": "TG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2768, "chemical_mass": 304790.0 } ] }, { "start_pos": "1365", "site_seq": "N", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01266-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "protein_name": "Thyroglobulin", "gene_name": "TG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2768, "chemical_mass": 304790.0 } ] }, { "start_pos": "1365", "site_seq": "N", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01266-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "protein_name": "Thyroglobulin", "gene_name": "TG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2768, "chemical_mass": 304790.0 } ] }, { "start_pos": "1365", "site_seq": "", "site_lbl": "N1365", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "8", "chr_pos": "132911467", "evidence": [ { "id": "P01266", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01266" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] }, { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "8", "chr_pos": "132911468", "evidence": [ { "id": "rs1819515531", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1819515531" }, { "id": "rs1819515531", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1819515531" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->YVT).", "chr_id": "8", "chr_pos": "132911467", "evidence": [ { "id": "rs142264604", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142264604" }, { "id": "rs142264604", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142264604" }, { "id": "rs142264604", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142264604#frequency_tab" }, { "id": "rs142264604", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142264604" } ], "disease": [ { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] }, { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] }, { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] }, { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01266-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "protein_name": "Thyroglobulin", "gene_name": "TG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2768, "chemical_mass": 304790.0 } ] }, { "start_pos": "1365", "site_seq": "N", "site_lbl": "Asn1365", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01266-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "protein_name": "Thyroglobulin", "gene_name": "TG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2768, "chemical_mass": 304790.0 } ] }, { "start_pos": "1365", "site_seq": "", "site_lbl": "N1365", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "8", "chr_pos": "132911467", "evidence": [ { "id": "P01266", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01266" } ], "disease": [ { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] }, { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "8", "chr_pos": "132911468", "evidence": [ { "id": "rs1819515531", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1819515531" }, { "id": "rs1819515531", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1819515531" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->YVT).", "chr_id": "8", "chr_pos": "132911467", "evidence": [ { "id": "rs142264604", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142264604" }, { "id": "rs142264604", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142264604" }, { "id": "rs142264604", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142264604#frequency_tab" }, { "id": "rs142264604", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142264604" } ], "disease": [ { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] }, { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] }, { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] }, { "disease_id": "DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22.", "url": "http://disease-ontology.org/term/DOID:0112187", "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01266-1", "start_pos": 1365, "end_pos": 1365, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "protein_name": "Thyroglobulin", "gene_name": "TG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2768, "chemical_mass": 304790.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "SLSnSTAR", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "NVTWKLGSR", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "SLSnSTAR", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "NVTWKLGSR", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "SLSnSTAR", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "NVTWKLGSR", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "", "site_lbl": "N120", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "11", "chr_pos": "75566708", "evidence": [ { "id": "rs757694413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757694413#frequency_tab" }, { "id": "rs757694413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757694413" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "11", "chr_pos": "75566707_75566708insCG", "evidence": [ { "id": "rs1420882595", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420882595" }, { "id": "rs1420882595", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420882595" }, { "id": "rs757694413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757694413#frequency_tab" }, { "id": "rs757694413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757694413" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "11", "chr_pos": "75566707", "evidence": [ { "id": "rs1942086877", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1942086877" }, { "id": "rs1942086877", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1942086877" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "11", "chr_pos": "75566724", "evidence": [ { "id": "rs772088561", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772088561" }, { "id": "rs772088561", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772088561" }, { "id": "rs772088561", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772088561#frequency_tab" }, { "id": "rs772088561", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772088561" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "75566723", "evidence": [ { "id": "rs1313938366", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1313938366" }, { "id": "rs1313938366", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1313938366#frequency_tab" }, { "id": "rs1313938366", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1313938366" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "N", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "SLSnSTAR", "site_lbl": "Asn120", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "NVTWKLGSR", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "120", "site_seq": "", "site_lbl": "N120", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "11", "chr_pos": "75566708", "evidence": [ { "id": "rs757694413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757694413#frequency_tab" }, { "id": "rs757694413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757694413" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->TST).", "chr_id": "11", "chr_pos": "75566707_75566708insCG", "evidence": [ { "id": "rs1420882595", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420882595" }, { "id": "rs1420882595", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420882595" }, { "id": "rs757694413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757694413" }, { "id": "rs757694413", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757694413#frequency_tab" }, { "id": "rs757694413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757694413" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->YST).", "chr_id": "11", "chr_pos": "75566707", "evidence": [ { "id": "rs1942086877", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1942086877" }, { "id": "rs1942086877", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1942086877" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 120, "end_pos": 120, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "11", "chr_pos": "75566724", "evidence": [ { "id": "rs772088561", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772088561" }, { "id": "rs772088561", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772088561" }, { "id": "rs772088561", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772088561#frequency_tab" }, { "id": "rs772088561", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772088561" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "11", "chr_pos": "75566723", "evidence": [ { "id": "rs1313938366", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1313938366" }, { "id": "rs1313938366", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1313938366#frequency_tab" }, { "id": "rs1313938366", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1313938366" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P50454-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "658", "url": "https://glyconnect.expasy.org/browser/proteins/658" } ], "protein_name": "Serpin H1", "gene_name": "SERPINH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46441.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "", "site_lbl": "N98", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "195571318", "evidence": [ { "id": "rs1577602196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577602196" }, { "id": "rs1577602196", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1577602196" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVnLTEPAKLEVK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "ADGTVNQIEGEATPVNLTEPAK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "98", "site_seq": "", "site_lbl": "N98", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "195571318", "evidence": [ { "id": "rs1577602196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577602196" }, { "id": "rs1577602196", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1577602196" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "N354", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "8", "chr_pos": "27599882", "evidence": [ { "id": "rs1800687134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1800687134" }, { "id": "rs1800687134", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1800687134" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "N354", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "8", "chr_pos": "27599882", "evidence": [ { "id": "rs1800687134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1800687134" }, { "id": "rs1800687134", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1800687134" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-374. Decreases secretion; when associated with Q-291 and Q-374.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "634", "site_seq": "N", "site_lbl": "Asn634", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 634, "end_pos": 634, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "764", "url": "https://glyconnect.expasy.org/browser/proteins/764" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "634", "site_seq": "nCTSFR", "site_lbl": "Asn634", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 634, "end_pos": 634, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "764", "url": "https://glyconnect.expasy.org/browser/proteins/764" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "634", "site_seq": "N", "site_lbl": "Asn634", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 634, "end_pos": 634, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "764", "url": "https://glyconnect.expasy.org/browser/proteins/764" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "634", "site_seq": "nCTSFR", "site_lbl": "Asn634", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 634, "end_pos": 634, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "764", "url": "https://glyconnect.expasy.org/browser/proteins/764" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "634", "site_seq": "N", "site_lbl": "Asn634", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 634, "end_pos": 634, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "764", "url": "https://glyconnect.expasy.org/browser/proteins/764" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "634", "site_seq": "nCTSFR", "site_lbl": "Asn634", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 634, "end_pos": 634, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "764", "url": "https://glyconnect.expasy.org/browser/proteins/764" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "634", "site_seq": "", "site_lbl": "N634", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "17", "chr_pos": "62677334", "evidence": [ { "id": "Q9UBG0", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UBG0" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 634, "end_pos": 634, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "764", "url": "https://glyconnect.expasy.org/browser/proteins/764" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "634", "site_seq": "N", "site_lbl": "Asn634", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 634, "end_pos": 634, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "764", "url": "https://glyconnect.expasy.org/browser/proteins/764" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "634", "site_seq": "nCTSFR", "site_lbl": "Asn634", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 634, "end_pos": 634, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "764", "url": "https://glyconnect.expasy.org/browser/proteins/764" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "634", "site_seq": "", "site_lbl": "N634", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "17", "chr_pos": "62677334", "evidence": [ { "id": "Q9UBG0", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9UBG0" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBG0-1", "start_pos": 634, "end_pos": 634, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "764", "url": "https://glyconnect.expasy.org/browser/proteins/764" } ], "protein_name": "C-type mannose receptor 2", "gene_name": "MRC2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 166674.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPnQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPnQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPnQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "", "site_lbl": "N362", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "12", "chr_pos": "64737018", "evidence": [ { "id": "rs1046086978", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1046086978" }, { "id": "rs1046086978", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1046086978#frequency_tab" }, { "id": "rs1046086978", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1046086978" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "rs1869575584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1869575584" }, { "id": "rs1869575584", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1869575584" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "P15586", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P15586" } ], "disease": [ { "disease_id": "DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder.", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPnQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "GPGIKPNQTSK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "362", "site_seq": "", "site_lbl": "N362", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->HQT).", "chr_id": "12", "chr_pos": "64737018", "evidence": [ { "id": "rs1046086978", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1046086978" }, { "id": "rs1046086978", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1046086978#frequency_tab" }, { "id": "rs1046086978", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1046086978" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "rs1869575584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1869575584" }, { "id": "rs1869575584", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1869575584" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "12", "chr_pos": "64737017", "evidence": [ { "id": "P15586", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P15586" } ], "disease": [ { "disease_id": "DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder.", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P15586-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "796", "url": "https://glyconnect.expasy.org/browser/proteins/796" } ], "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 552, "chemical_mass": 62082.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "8", "chr_pos": "18059633", "evidence": [ { "id": "rs1799610079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799610079" }, { "id": "rs1799610079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799610079" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "8", "chr_pos": "18059632", "evidence": [ { "id": "rs371154344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371154344#frequency_tab" }, { "id": "rs371154344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371154344" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "8", "chr_pos": "18059633", "evidence": [ { "id": "rs1799610079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799610079" }, { "id": "rs1799610079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799610079" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "8", "chr_pos": "18059632", "evidence": [ { "id": "rs371154344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371154344#frequency_tab" }, { "id": "rs371154344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371154344" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on ceramide catabolic process.", "evidence": [ { "database": "UniProtKB", "id": "Q13510", "url": "https://www.uniprot.org/uniprotkb/Q13510" }, { "database": "PubMed", "id": "11451951", "url": "https://glygen.org/publication/PubMed/11451951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" }, { "database": "GlyConnect", "id": "986", "url": "https://glyconnect.expasy.org/browser/proteins/986" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "AGPnGTLFVADAYK", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "AGPnGTLFVADAYK", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "AGPnGTLFVADAYK", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "", "site_lbl": "N160", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "20", "chr_pos": "24971519", "evidence": [ { "id": "rs149732546", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149732546" }, { "id": "rs149732546", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149732546" }, { "id": "rs149732546", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149732546" }, { "id": "rs149732546", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149732546#frequency_tab" }, { "id": "rs149732546", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149732546" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "AGPnGTLFVADAYK", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "160", "site_seq": "", "site_lbl": "N160", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "20", "chr_pos": "24971519", "evidence": [ { "id": "rs149732546", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149732546" }, { "id": "rs149732546", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149732546" }, { "id": "rs149732546", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149732546" }, { "id": "rs149732546", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149732546#frequency_tab" }, { "id": "rs149732546", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149732546" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HDC9-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "24721674", "url": "https://glygen.org/publication/PubMed/24721674" }, { "database": "GlyConnect", "id": "797", "url": "https://glyconnect.expasy.org/browser/proteins/797" } ], "protein_name": "Adipocyte plasma membrane-associated protein", "gene_name": "APMAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 416, "chemical_mass": 46480.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "RDAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "DAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "RDAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "DAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "RDAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "DAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "RDAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "109", "site_seq": "DAMVGNYTCEVTELSR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61735-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2479", "url": "https://glyconnect.expasy.org/browser/proteins/2479" } ], "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 303, "chemical_mass": 33098.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24638-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2489", "url": "https://glyconnect.expasy.org/browser/proteins/2489" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "Acp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 423, "chemical_mass": 48509.0 } ] }, { "start_pos": "177", "site_seq": "QTPEYQNR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24638-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2489", "url": "https://glyconnect.expasy.org/browser/proteins/2489" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "Acp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 423, "chemical_mass": 48509.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24638-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2489", "url": "https://glyconnect.expasy.org/browser/proteins/2489" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "Acp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 423, "chemical_mass": 48509.0 } ] }, { "start_pos": "177", "site_seq": "QTPEYQNR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24638-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2489", "url": "https://glyconnect.expasy.org/browser/proteins/2489" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "Acp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 423, "chemical_mass": 48509.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24638-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2489", "url": "https://glyconnect.expasy.org/browser/proteins/2489" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "Acp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 423, "chemical_mass": 48509.0 } ] }, { "start_pos": "177", "site_seq": "QTPEYQNR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24638-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2489", "url": "https://glyconnect.expasy.org/browser/proteins/2489" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "Acp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 423, "chemical_mass": 48509.0 } ] }, { "start_pos": "177", "site_seq": "N", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24638-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2489", "url": "https://glyconnect.expasy.org/browser/proteins/2489" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "Acp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 423, "chemical_mass": 48509.0 } ] }, { "start_pos": "177", "site_seq": "QTPEYQNR", "site_lbl": "Asn177", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P24638-1", "start_pos": 177, "end_pos": 177, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2489", "url": "https://glyconnect.expasy.org/browser/proteins/2489" } ], "protein_name": "Lysosomal acid phosphatase", "gene_name": "Acp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 423, "chemical_mass": 48509.0 } ] }, { "start_pos": "140", "site_seq": "N", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "140", "site_seq": "LENLSSTESGYTATLTR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "140", "site_seq": "N", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "140", "site_seq": "LENLSSTESGYTATLTR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "140", "site_seq": "N", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "140", "site_seq": "LENLSSTESGYTATLTR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "140", "site_seq": "N", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "140", "site_seq": "LENLSSTESGYTATLTR", "site_lbl": "Asn140", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P70699-1", "start_pos": 140, "end_pos": 140, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2490", "url": "https://glyconnect.expasy.org/browser/proteins/2490" } ], "protein_name": "Lysosomal alpha-glucosidase", "gene_name": "Gaa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 953, "chemical_mass": 106248.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "156", "site_seq": "CNSVLTYNLTPVVQK", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "156", "site_seq": "CNSVLTYNLTPVVQK", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "156", "site_seq": "CNSVLTYNLTPVVQK", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "156", "site_seq": "CNSVLTYNLTPVVQK", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17047-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2495", "url": "https://glyconnect.expasy.org/browser/proteins/2495" } ], "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 415, "chemical_mass": 45681.0 } ] }, { "start_pos": "439", "site_seq": "N", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYS2-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2508", "url": "https://glyconnect.expasy.org/browser/proteins/2508" } ], "protein_name": "Metabotropic glutamate receptor 3", "gene_name": "Grm3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 879, "chemical_mass": 99114.0 } ] }, { "start_pos": "439", "site_seq": "INFTAPFNPNK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYS2-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2508", "url": "https://glyconnect.expasy.org/browser/proteins/2508" } ], "protein_name": "Metabotropic glutamate receptor 3", "gene_name": "Grm3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 879, "chemical_mass": 99114.0 } ] }, { "start_pos": "439", "site_seq": "N", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYS2-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2508", "url": "https://glyconnect.expasy.org/browser/proteins/2508" } ], "protein_name": "Metabotropic glutamate receptor 3", "gene_name": "Grm3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 879, "chemical_mass": 99114.0 } ] }, { "start_pos": "439", "site_seq": "INFTAPFNPNK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYS2-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2508", "url": "https://glyconnect.expasy.org/browser/proteins/2508" } ], "protein_name": "Metabotropic glutamate receptor 3", "gene_name": "Grm3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 879, "chemical_mass": 99114.0 } ] }, { "start_pos": "439", "site_seq": "N", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYS2-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2508", "url": "https://glyconnect.expasy.org/browser/proteins/2508" } ], "protein_name": "Metabotropic glutamate receptor 3", "gene_name": "Grm3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 879, "chemical_mass": 99114.0 } ] }, { "start_pos": "439", "site_seq": "INFTAPFNPNK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYS2-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2508", "url": "https://glyconnect.expasy.org/browser/proteins/2508" } ], "protein_name": "Metabotropic glutamate receptor 3", "gene_name": "Grm3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 879, "chemical_mass": 99114.0 } ] }, { "start_pos": "439", "site_seq": "N", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYS2-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2508", "url": "https://glyconnect.expasy.org/browser/proteins/2508" } ], "protein_name": "Metabotropic glutamate receptor 3", "gene_name": "Grm3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 879, "chemical_mass": 99114.0 } ] }, { "start_pos": "439", "site_seq": "INFTAPFNPNK", "site_lbl": "Asn439", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9QYS2-1", "start_pos": 439, "end_pos": 439, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2508", "url": "https://glyconnect.expasy.org/browser/proteins/2508" } ], "protein_name": "Metabotropic glutamate receptor 3", "gene_name": "Grm3", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 879, "chemical_mass": 99114.0 } ] }, { "start_pos": "99", "site_seq": "N", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "99", "site_seq": "NCTLLLSTLSPELGGK", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "99", "site_seq": "N", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "99", "site_seq": "NCTLLLSTLSPELGGK", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "99", "site_seq": "N", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "99", "site_seq": "NCTLLLSTLSPELGGK", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "99", "site_seq": "N", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "99", "site_seq": "NCTLLLSTLSPELGGK", "site_lbl": "Asn99", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20917-1", "start_pos": 99, "end_pos": 99, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2519", "url": "https://glyconnect.expasy.org/browser/proteins/2519" } ], "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 627, "chemical_mass": 69388.0 } ] }, { "start_pos": "670", "site_seq": "N", "site_lbl": "Asn670", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 670, "end_pos": 670, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "670", "site_seq": "VPGNQTSTTLK", "site_lbl": "Asn670", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 670, "end_pos": 670, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "670", "site_seq": "N", "site_lbl": "Asn670", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 670, "end_pos": 670, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "670", "site_seq": "VPGNQTSTTLK", "site_lbl": "Asn670", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 670, "end_pos": 670, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "670", "site_seq": "N", "site_lbl": "Asn670", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 670, "end_pos": 670, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "670", "site_seq": "VPGNQTSTTLK", "site_lbl": "Asn670", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 670, "end_pos": 670, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "670", "site_seq": "N", "site_lbl": "Asn670", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 670, "end_pos": 670, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "670", "site_seq": "VPGNQTSTTLK", "site_lbl": "Asn670", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11627-1", "start_pos": 670, "end_pos": 670, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2537", "url": "https://glyconnect.expasy.org/browser/proteins/2537" } ], "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1260, "chemical_mass": 140969.0 } ] }, { "start_pos": "3954", "site_seq": "N", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "GVTHLNISGLK", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "N", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "GVTHLNISGLK", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "N", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "GVTHLNISGLK", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "N", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "3954", "site_seq": "GVTHLNISGLK", "site_lbl": "Asn3954", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZX7-1", "start_pos": 3954, "end_pos": 3954, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2611", "url": "https://glyconnect.expasy.org/browser/proteins/2611" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "Lrp1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 4545, "chemical_mass": 504742.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "214", "site_seq": "TNSSFIQGFVDHVK", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "459", "site_seq": "N", "site_lbl": "Asn459", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 459, "end_pos": 459, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "459", "site_seq": "NSTKEEILAALEK", "site_lbl": "Asn459", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 459, "end_pos": 459, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "80", "site_seq": "DNATQEEILHYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "214", "site_seq": "TNSSFIQGFVDHVK", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "459", "site_seq": "N", "site_lbl": "Asn459", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 459, "end_pos": 459, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "459", "site_seq": "NSTKEEILAALEK", "site_lbl": "Asn459", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 459, "end_pos": 459, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "80", "site_seq": "DNATQEEILHYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "214", "site_seq": "TNSSFIQGFVDHVK", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "459", "site_seq": "N", "site_lbl": "Asn459", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 459, "end_pos": 459, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "459", "site_seq": "NSTKEEILAALEK", "site_lbl": "Asn459", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 459, "end_pos": 459, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "80", "site_seq": "DNATQEEILHYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "214", "site_seq": "N", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "214", "site_seq": "TNSSFIQGFVDHVK", "site_lbl": "Asn214", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 214, "end_pos": 214, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "459", "site_seq": "N", "site_lbl": "Asn459", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 459, "end_pos": 459, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "459", "site_seq": "NSTKEEILAALEK", "site_lbl": "Asn459", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 459, "end_pos": 459, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "80", "site_seq": "N", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "80", "site_seq": "DNATQEEILHYLEK", "site_lbl": "Asn80", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q61207-1", "start_pos": 80, "end_pos": 80, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2615", "url": "https://glyconnect.expasy.org/browser/proteins/2615" } ], "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 557, "chemical_mass": 61422.0 } ] }, { "start_pos": "47", "site_seq": "N", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05186-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2679", "url": "https://glyconnect.expasy.org/browser/proteins/2679" } ], "protein_name": "Reticulocalbin-1", "gene_name": "Rcn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 325, "chemical_mass": 38113.0 } ] }, { "start_pos": "47", "site_seq": "VVRPDSELGERPPEDNQSFQYDHEAFLGK", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05186-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2679", "url": "https://glyconnect.expasy.org/browser/proteins/2679" } ], "protein_name": "Reticulocalbin-1", "gene_name": "Rcn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 325, "chemical_mass": 38113.0 } ] }, { "start_pos": "47", "site_seq": "N", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05186-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2679", "url": "https://glyconnect.expasy.org/browser/proteins/2679" } ], "protein_name": "Reticulocalbin-1", "gene_name": "Rcn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 325, "chemical_mass": 38113.0 } ] }, { "start_pos": "47", "site_seq": "VVRPDSELGERPPEDNQSFQYDHEAFLGK", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05186-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2679", "url": "https://glyconnect.expasy.org/browser/proteins/2679" } ], "protein_name": "Reticulocalbin-1", "gene_name": "Rcn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 325, "chemical_mass": 38113.0 } ] }, { "start_pos": "47", "site_seq": "N", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05186-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2679", "url": "https://glyconnect.expasy.org/browser/proteins/2679" } ], "protein_name": "Reticulocalbin-1", "gene_name": "Rcn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 325, "chemical_mass": 38113.0 } ] }, { "start_pos": "47", "site_seq": "VVRPDSELGERPPEDNQSFQYDHEAFLGK", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05186-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2679", "url": "https://glyconnect.expasy.org/browser/proteins/2679" } ], "protein_name": "Reticulocalbin-1", "gene_name": "Rcn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 325, "chemical_mass": 38113.0 } ] }, { "start_pos": "47", "site_seq": "N", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05186-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2679", "url": "https://glyconnect.expasy.org/browser/proteins/2679" } ], "protein_name": "Reticulocalbin-1", "gene_name": "Rcn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 325, "chemical_mass": 38113.0 } ] }, { "start_pos": "47", "site_seq": "VVRPDSELGERPPEDNQSFQYDHEAFLGK", "site_lbl": "Asn47", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q05186-1", "start_pos": 47, "end_pos": 47, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2679", "url": "https://glyconnect.expasy.org/browser/proteins/2679" } ], "protein_name": "Reticulocalbin-1", "gene_name": "Rcn1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 325, "chemical_mass": 38113.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "VTQQSPTSMNQVNLTCR", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "N", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "NVSDTTK", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "VTQQSPTSMNQVNLTCR", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "N", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "NVSDTTK", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "VTQQSPTSMNQVNLTCR", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "N", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "NVSDTTK", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "2", "chr_pos": "129458196", "evidence": [ { "id": "rs3388588006", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388588006" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "VTQQSPTSMNQVNLTCR", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "N", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "92", "site_seq": "NVSDTTK", "site_lbl": "Asn92", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 92, "end_pos": 92, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "2", "chr_pos": "129458196", "evidence": [ { "id": "rs3388588006", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388588006" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P97797-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2714", "url": "https://glyconnect.expasy.org/browser/proteins/2714" } ], "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 513, "chemical_mass": 56414.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "42", "site_seq": "HENNTKDNSIQHEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "42", "site_seq": "HENNTKDNSIQHEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "42", "site_seq": "HENNTKDNSIQHEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "42", "site_seq": "N", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "42", "site_seq": "HENNTKDNSIQHEFSLTR", "site_lbl": "Asn42", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01831-1", "start_pos": 42, "end_pos": 42, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2769", "url": "https://glyconnect.expasy.org/browser/proteins/2769" } ], "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 162, "chemical_mass": 18080.0 } ] }, { "start_pos": "748", "site_seq": "N", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56695-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2828", "url": "https://glyconnect.expasy.org/browser/proteins/2828" } ], "protein_name": "Wolframin", "gene_name": "Wfs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 890, "chemical_mass": 100579.0 } ] }, { "start_pos": "748", "site_seq": "CLYGEAYPSCSSGNTSTAEEELCR", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56695-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2828", "url": "https://glyconnect.expasy.org/browser/proteins/2828" } ], "protein_name": "Wolframin", "gene_name": "Wfs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 890, "chemical_mass": 100579.0 } ] }, { "start_pos": "748", "site_seq": "N", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56695-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2828", "url": "https://glyconnect.expasy.org/browser/proteins/2828" } ], "protein_name": "Wolframin", "gene_name": "Wfs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 890, "chemical_mass": 100579.0 } ] }, { "start_pos": "748", "site_seq": "CLYGEAYPSCSSGNTSTAEEELCR", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56695-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2828", "url": "https://glyconnect.expasy.org/browser/proteins/2828" } ], "protein_name": "Wolframin", "gene_name": "Wfs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 890, "chemical_mass": 100579.0 } ] }, { "start_pos": "748", "site_seq": "N", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56695-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2828", "url": "https://glyconnect.expasy.org/browser/proteins/2828" } ], "protein_name": "Wolframin", "gene_name": "Wfs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 890, "chemical_mass": 100579.0 } ] }, { "start_pos": "748", "site_seq": "CLYGEAYPSCSSGNTSTAEEELCR", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56695-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2828", "url": "https://glyconnect.expasy.org/browser/proteins/2828" } ], "protein_name": "Wolframin", "gene_name": "Wfs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 890, "chemical_mass": 100579.0 } ] }, { "start_pos": "748", "site_seq": "N", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56695-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2828", "url": "https://glyconnect.expasy.org/browser/proteins/2828" } ], "protein_name": "Wolframin", "gene_name": "Wfs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 890, "chemical_mass": 100579.0 } ] }, { "start_pos": "748", "site_seq": "CLYGEAYPSCSSGNTSTAEEELCR", "site_lbl": "Asn748", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P56695-1", "start_pos": 748, "end_pos": 748, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2828", "url": "https://glyconnect.expasy.org/browser/proteins/2828" } ], "protein_name": "Wolframin", "gene_name": "Wfs1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 890, "chemical_mass": 100579.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "261", "site_seq": "YYHGELSYLNVTR", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "261", "site_seq": "YYHGELSYLNVTR", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "261", "site_seq": "YYHGELSYLNVTR", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "261", "site_seq": "N", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "261", "site_seq": "YYHGELSYLNVTR", "site_lbl": "Asn261", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P18242-1", "start_pos": 261, "end_pos": 261, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2190", "url": "https://glyconnect.expasy.org/browser/proteins/2190" } ], "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 410, "chemical_mass": 44954.0 } ] }, { "start_pos": "148", "site_seq": "N", "site_lbl": "Asn148", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K209-1", "start_pos": 148, "end_pos": 148, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2362", "url": "https://glyconnect.expasy.org/browser/proteins/2362" } ], "protein_name": "Adhesion G-protein coupled receptor G1", "gene_name": "Adgrg1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 687, "chemical_mass": 77255.0 } ] }, { "start_pos": "148", "site_seq": "N", "site_lbl": "Asn148", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K209-1", "start_pos": 148, "end_pos": 148, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2362", "url": "https://glyconnect.expasy.org/browser/proteins/2362" } ], "protein_name": "Adhesion G-protein coupled receptor G1", "gene_name": "Adgrg1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 687, "chemical_mass": 77255.0 } ] }, { "start_pos": "148", "site_seq": "N", "site_lbl": "Asn148", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K209-1", "start_pos": 148, "end_pos": 148, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2362", "url": "https://glyconnect.expasy.org/browser/proteins/2362" } ], "protein_name": "Adhesion G-protein coupled receptor G1", "gene_name": "Adgrg1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 687, "chemical_mass": 77255.0 } ] }, { "start_pos": "148", "site_seq": "N", "site_lbl": "Asn148", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8K209-1", "start_pos": 148, "end_pos": 148, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2362", "url": "https://glyconnect.expasy.org/browser/proteins/2362" } ], "protein_name": "Adhesion G-protein coupled receptor G1", "gene_name": "Adgrg1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 687, "chemical_mass": 77255.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASAGDQEEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASAGDQEEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASAGDQEEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "931", "site_seq": "N", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "931", "site_seq": "AEPPLNASAGDQEEK", "site_lbl": "Asn931", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9JKR6-1", "start_pos": 931, "end_pos": 931, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376" } ], "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "Hyou1", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 999, "chemical_mass": 111181.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "48", "site_seq": "VAGTAVSISCNVSDYEGPAQQDFEWFMYR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "48", "site_seq": "VAGTAVSISCNVSDYEGPAQQDFEWFMYR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "48", "site_seq": "VAGTAVSISCNVSDYEGPAQQDFEWFMYR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "48", "site_seq": "N", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "48", "site_seq": "VAGTAVSISCNVSDYEGPAQQDFEWFMYR", "site_lbl": "Asn48", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8R366-1", "start_pos": 48, "end_pos": 48, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" }, { "database": "GlyConnect", "id": "2384", "url": "https://glyconnect.expasy.org/browser/proteins/2384" } ], "protein_name": "Immunoglobulin superfamily member 8", "gene_name": "Igsf8", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 611, "chemical_mass": 65011.0 } ] }, { "start_pos": "1074", "site_seq": "N", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "709", "site_seq": "N", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1074", "site_seq": "N", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "709", "site_seq": "N", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1074", "site_seq": "N", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "709", "site_seq": "N", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1074", "site_seq": "N", "site_lbl": "Asn1074", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1074, "end_pos": 1074, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "1098", "site_seq": "N", "site_lbl": "Asn1098", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 1098, "end_pos": 1098, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" }, { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "122", "site_seq": "N", "site_lbl": "Asn122", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 122, "end_pos": 122, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "17", "site_seq": "N", "site_lbl": "Asn17", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 17, "end_pos": 17, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "N", "site_lbl": "Asn331", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "N", "site_lbl": "Asn343", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "61", "site_seq": "N", "site_lbl": "Asn61", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 61, "end_pos": 61, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "709", "site_seq": "N", "site_lbl": "Asn709", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 709, "end_pos": 709, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "33077685", "url": "https://glygen.org/publication/PubMed/33077685" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "74", "site_seq": "N", "site_lbl": "Asn74", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 74, "end_pos": 74, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" }, { "database": "GlyConnect", "id": "2840", "url": "https://glyconnect.expasy.org/browser/proteins/2840" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "331", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Reduced viral infectivity.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "32730807", "url": "https://glygen.org/publication/PubMed/32730807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 331, "end_pos": 331, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] }, { "start_pos": "343", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Reduced viral infectivity.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "32730807", "url": "https://glygen.org/publication/PubMed/32730807" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P0DTC2-1", "start_pos": 343, "end_pos": 343, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" }, { "database": "GlyConnect", "id": "2839", "url": "https://glyconnect.expasy.org/browser/proteins/2839" } ], "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_id": 2697049, "tax_name": "Severe acute respiratory syndrome coronavirus 2", "tax_common_name": "2019-nCoV", "length": 1273, "chemical_mass": 141178.0 } ] } ], "record_id": "G00406II" }