{ "glytoucan_ac": "G00273SJ", "species": [ { "taxid": 9606, "name": "Homo sapiens", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000888", "url": "https://data.glygen.org/GLY_000888" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" }, { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" }, { "taxid": 10090, "name": "Mus musculus", "annotation_category": "direct", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mass": 2224.82, "classification": [ { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Arm-fucosylated" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Biantennary" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Bisected" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Complex", "url": "" } }, { "type": { "name": "N-linked", "url": "" }, "subtype": { "name": "Core-fucosylated" } } ], "composition": [ { "name": "6-Deoxy-Hexose", "residue": "dhex", "count": 4, "cid": "840", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/840" }, { "name": "Hexose", "residue": "hex", "count": 5, "cid": "206", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/206" }, { "name": "N-Acetylhexosamine", "residue": "hexnac", "count": 4, "cid": "899", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/899" }, { "name": "Hexuronic Acid", "residue": "hexa", "count": 0, "cid": "610", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/610" }, { "name": "2-Amino-2-Deoxy-Hexose", "residue": "hexn", "count": 0, "cid": "739", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/739" }, { "name": "N-Acetyl-Neuraminic Acid", "residue": "neuac", "count": 0, "cid": "439197", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/439197" }, { "name": "N-Glycolyl-Neuraminic Acid", "residue": "neugc", "count": 0, "cid": "440001", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/440001" }, { "name": "Phosphate", "residue": "p", "count": 0, "cid": "1061", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1061" }, { "name": "Pentose", "residue": "pent", "count": 0, "cid": "229", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/229" }, { "name": "Sulfate", "residue": "s", "count": 0, "cid": "1117", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/1117" }, { "name": "Other", "residue": "other", "count": 0 } ], "motifs": [], "enzyme": [], "biomarkers": [], "binding_proteins": [], "sites": [ { "start_pos": "1368", "site_seq": "QGEHLSNSTSAFSTR", "site_lbl": "Asn1368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1368, "end_pos": 1368, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1368", "site_seq": "N", "site_lbl": "Asn1368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1368, "end_pos": 1368, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1368", "site_seq": "QGEHLSNSTSAFSTR", "site_lbl": "Asn1368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1368, "end_pos": 1368, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1368", "site_seq": "N", "site_lbl": "Asn1368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1368, "end_pos": 1368, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1368", "site_seq": "QGEHLSNSTSAFSTR", "site_lbl": "Asn1368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1368, "end_pos": 1368, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1368", "site_seq": "N", "site_lbl": "Asn1368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1368, "end_pos": 1368, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1368", "site_seq": "", "site_lbl": "N1368", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "2", "chr_pos": "1638948", "evidence": [ { "id": "rs1447444077", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1447444077" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1368, "end_pos": 1368, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1368", "site_seq": "QGEHLSNSTSAFSTR", "site_lbl": "Asn1368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1368, "end_pos": 1368, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1368", "site_seq": "N", "site_lbl": "Asn1368", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1368, "end_pos": 1368, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "1368", "site_seq": "", "site_lbl": "N1368", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "2", "chr_pos": "1638948", "evidence": [ { "id": "rs1447444077", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1447444077" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92626-1", "start_pos": 1368, "end_pos": 1368, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Peroxidasin homolog", "gene_name": "PXDN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1479, "chemical_mass": 165275.0 } ] }, { "start_pos": "907", "site_seq": "KGLSNYAVTFQRGDGGLMSNGSR", "site_lbl": "Asn907", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HCK4-1", "start_pos": 907, "end_pos": 907, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Roundabout homolog 2", "gene_name": "ROBO2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1378, "chemical_mass": 151200.0 } ] }, { "start_pos": "907", "site_seq": "KGLSNYAVTFQRGDGGLMSNGSR", "site_lbl": "Asn907", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HCK4-1", "start_pos": 907, "end_pos": 907, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Roundabout homolog 2", "gene_name": "ROBO2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1378, "chemical_mass": 151200.0 } ] }, { "start_pos": "907", "site_seq": "KGLSNYAVTFQRGDGGLMSNGSR", "site_lbl": "Asn907", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HCK4-1", "start_pos": 907, "end_pos": 907, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Roundabout homolog 2", "gene_name": "ROBO2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1378, "chemical_mass": 151200.0 } ] }, { "start_pos": "907", "site_seq": "", "site_lbl": "N907", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "3", "chr_pos": "77595177", "evidence": [ { "id": "rs1473511144", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1473511144" }, { "id": "rs1473511144", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1473511144#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HCK4-1", "start_pos": 907, "end_pos": 907, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Roundabout homolog 2", "gene_name": "ROBO2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1378, "chemical_mass": 151200.0 } ] }, { "start_pos": "907", "site_seq": "KGLSNYAVTFQRGDGGLMSNGSR", "site_lbl": "Asn907", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HCK4-1", "start_pos": 907, "end_pos": 907, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Roundabout homolog 2", "gene_name": "ROBO2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1378, "chemical_mass": 151200.0 } ] }, { "start_pos": "907", "site_seq": "", "site_lbl": "N907", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "3", "chr_pos": "77595177", "evidence": [ { "id": "rs1473511144", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1473511144" }, { "id": "rs1473511144", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1473511144#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HCK4-1", "start_pos": 907, "end_pos": 907, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Roundabout homolog 2", "gene_name": "ROBO2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1378, "chemical_mass": 151200.0 } ] }, { "start_pos": "577", "site_seq": "KTNHSSPEAQSK", "site_lbl": "Asn577", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95819-1", "start_pos": 577, "end_pos": 577, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Mitogen-activated protein kinase kinase kinase kinase 4", "gene_name": "MAP4K4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1239, "chemical_mass": 142101.0 } ] }, { "start_pos": "577", "site_seq": "KTNHSSPEAQSK", "site_lbl": "Asn577", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95819-1", "start_pos": 577, "end_pos": 577, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Mitogen-activated protein kinase kinase kinase kinase 4", "gene_name": "MAP4K4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1239, "chemical_mass": 142101.0 } ] }, { "start_pos": "577", "site_seq": "KTNHSSPEAQSK", "site_lbl": "Asn577", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95819-1", "start_pos": 577, "end_pos": 577, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Mitogen-activated protein kinase kinase kinase kinase 4", "gene_name": "MAP4K4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1239, "chemical_mass": 142101.0 } ] }, { "start_pos": "577", "site_seq": "", "site_lbl": "N577", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHS->KHS).", "chr_id": "2", "chr_pos": "101860851", "evidence": [ { "id": "O95819", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O95819" }, { "id": "rs2097630275", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2097630275" }, { "id": "rs2097630275", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2097630275" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95819-1", "start_pos": 577, "end_pos": 577, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Mitogen-activated protein kinase kinase kinase kinase 4", "gene_name": "MAP4K4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1239, "chemical_mass": 142101.0 } ] }, { "start_pos": "577", "site_seq": "KTNHSSPEAQSK", "site_lbl": "Asn577", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O95819-1", "start_pos": 577, "end_pos": 577, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Mitogen-activated protein kinase kinase kinase kinase 4", "gene_name": "MAP4K4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1239, "chemical_mass": 142101.0 } ] }, { "start_pos": "577", "site_seq": "", "site_lbl": "N577", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHS->KHS).", "chr_id": "2", "chr_pos": "101860851", "evidence": [ { "id": "O95819", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O95819" }, { "id": "rs2097630275", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2097630275" }, { "id": "rs2097630275", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2097630275" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O95819-1", "start_pos": 577, "end_pos": 577, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "Data Submission", "id": "GLY_000888", "url": "http://data.glygen.org/GLY_000888" } ], "protein_name": "Mitogen-activated protein kinase kinase kinase kinase 4", "gene_name": "MAP4K4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1239, "chemical_mass": 142101.0 } ] }, { "start_pos": "786", "site_seq": "NISEFISR", "site_lbl": "Asn786", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZU9-1", "start_pos": 786, "end_pos": 786, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 3B", "gene_name": "Grin3b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1003, "chemical_mass": 109158.0 } ] }, { "start_pos": "786", "site_seq": "N", "site_lbl": "Asn786", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZU9-1", "start_pos": 786, "end_pos": 786, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 3B", "gene_name": "Grin3b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1003, "chemical_mass": 109158.0 } ] }, { "start_pos": "786", "site_seq": "NISEFISR", "site_lbl": "Asn786", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZU9-1", "start_pos": 786, "end_pos": 786, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 3B", "gene_name": "Grin3b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1003, "chemical_mass": 109158.0 } ] }, { "start_pos": "786", "site_seq": "N", "site_lbl": "Asn786", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZU9-1", "start_pos": 786, "end_pos": 786, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 3B", "gene_name": "Grin3b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1003, "chemical_mass": 109158.0 } ] }, { "start_pos": "786", "site_seq": "NISEFISR", "site_lbl": "Asn786", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZU9-1", "start_pos": 786, "end_pos": 786, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 3B", "gene_name": "Grin3b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1003, "chemical_mass": 109158.0 } ] }, { "start_pos": "786", "site_seq": "N", "site_lbl": "Asn786", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZU9-1", "start_pos": 786, "end_pos": 786, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 3B", "gene_name": "Grin3b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1003, "chemical_mass": 109158.0 } ] }, { "start_pos": "786", "site_seq": "NISEFISR", "site_lbl": "Asn786", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZU9-1", "start_pos": 786, "end_pos": 786, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 3B", "gene_name": "Grin3b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1003, "chemical_mass": 109158.0 } ] }, { "start_pos": "786", "site_seq": "N", "site_lbl": "Asn786", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q91ZU9-1", "start_pos": 786, "end_pos": 786, "residue": "Asn", "evidence": [ { "database": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "protein_name": "Glutamate receptor ionotropic, NMDA 3B", "gene_name": "Grin3b", "tax_id": 10090, "tax_name": "Mus musculus", "tax_common_name": "Mouse", "length": 1003, "chemical_mass": 109158.0 } ] }, { "start_pos": "399", "site_seq": "EDAQInTTIGSVTAQDPDAAR", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "EDAQInTTIGSVTAQDPDAARNPVK", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "N", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "LLDRETLLWHnITVIATEINNPK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "ETLLWHnITVIATEINNPK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "N", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "EDAQInTTIGSVTAQDPDAAR", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "EDAQInTTIGSVTAQDPDAARNPVK", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "N", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "LLDRETLLWHnITVIATEINNPK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "ETLLWHnITVIATEINNPK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "N", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "EDAQInTTIGSVTAQDPDAAR", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "EDAQInTTIGSVTAQDPDAARNPVK", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "N", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "LLDRETLLWHnITVIATEINNPK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "ETLLWHnITVIATEINNPK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "N", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "", "site_lbl": "N399", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "5", "chr_pos": "31305369", "evidence": [ { "id": "rs1306227333", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1306227333" }, { "id": "rs1306227333", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1306227333" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "EDAQInTTIGSVTAQDPDAAR", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "EDAQInTTIGSVTAQDPDAARNPVK", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "N", "site_lbl": "Asn399", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "LLDRETLLWHnITVIATEINNPK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "ETLLWHnITVIATEINNPK", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "455", "site_seq": "N", "site_lbl": "Asn455", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 455, "end_pos": 455, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "399", "site_seq": "", "site_lbl": "N399", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "5", "chr_pos": "31305369", "evidence": [ { "id": "rs1306227333", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1306227333" }, { "id": "rs1306227333", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1306227333" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55285-1", "start_pos": 399, "end_pos": 399, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-6", "gene_name": "CDH6", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 790, "chemical_mass": 88309.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "", "site_lbl": "N511", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "22", "chr_pos": "24628357", "evidence": [ { "id": "rs1259125092", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1259125092" }, { "id": "rs1259125092", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1259125092" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPnVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "N", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "LHNQLLPNVTTVER", "site_lbl": "Asn511", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "511", "site_seq": "", "site_lbl": "N511", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "22", "chr_pos": "24628357", "evidence": [ { "id": "rs1259125092", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1259125092" }, { "id": "rs1259125092", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1259125092" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19440-1", "start_pos": 511, "end_pos": 511, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutathione hydrolase 1 proenzyme", "gene_name": "GGT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 61410.0 } ] }, { "start_pos": "211", "site_seq": "ASPPSSSCnISSGEMQK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "GLQPTLTNPGECRPnFTCACR", "site_lbl": "Asn2357", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "N", "site_lbl": "Asn2357", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "nVSCPQLEVPVCPSGFQLSCK", "site_lbl": "Asn2546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "N", "site_lbl": "Asn2546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "MEACMLnGTVIGPGK", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "N", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "ASPPSSSCnISSGEMQK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "GLQPTLTNPGECRPnFTCACR", "site_lbl": "Asn2357", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "N", "site_lbl": "Asn2357", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "nVSCPQLEVPVCPSGFQLSCK", "site_lbl": "Asn2546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "N", "site_lbl": "Asn2546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "MEACMLnGTVIGPGK", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "N", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "ASPPSSSCnISSGEMQK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "GLQPTLTNPGECRPnFTCACR", "site_lbl": "Asn2357", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "N", "site_lbl": "Asn2357", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "nVSCPQLEVPVCPSGFQLSCK", "site_lbl": "Asn2546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "N", "site_lbl": "Asn2546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "MEACMLnGTVIGPGK", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "N", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "12", "chr_pos": "6095485", "evidence": [ { "id": "P04275", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P04275" }, { "id": "rs753796586", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753796586" }, { "id": "rs753796586", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753796586" }, { "id": "rs753796586", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753796586#frequency_tab" }, { "id": "rs753796586", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753796586" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "", "site_lbl": "N2357", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->IFT).", "chr_id": "12", "chr_pos": "5983161", "evidence": [ { "id": "rs750296925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750296925#frequency_tab" }, { "id": "rs750296925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750296925" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->KFT).", "chr_id": "12", "chr_pos": "5983160", "evidence": [ { "id": "rs765168583", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765168583" }, { "id": "rs765168583", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765168583" }, { "id": "rs765168583", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765168583#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "12", "chr_pos": "5983161", "evidence": [ { "id": "rs750296925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750296925#frequency_tab" }, { "id": "rs750296925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750296925" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "12", "chr_pos": "5983161", "evidence": [ { "id": "rs750296925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750296925#frequency_tab" }, { "id": "rs750296925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750296925" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "", "site_lbl": "N2546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->YVS).", "chr_id": "12", "chr_pos": "5969304", "evidence": [ { "id": "rs61751298", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61751298" }, { "id": "rs61751298", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61751298" } ], "disease": [ { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "", "site_lbl": "N2585", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "12", "chr_pos": "5968143", "evidence": [ { "id": "rs2136354943", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2136354943" }, { "id": "rs2136354943", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2136354943" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "ASPPSSSCnISSGEMQK", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "N", "site_lbl": "Asn211", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "GLQPTLTNPGECRPnFTCACR", "site_lbl": "Asn2357", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "N", "site_lbl": "Asn2357", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "nVSCPQLEVPVCPSGFQLSCK", "site_lbl": "Asn2546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "N", "site_lbl": "Asn2546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "MEACMLnGTVIGPGK", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "N", "site_lbl": "Asn2585", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "211", "site_seq": "", "site_lbl": "N211", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "12", "chr_pos": "6095485", "evidence": [ { "id": "P04275", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P04275" }, { "id": "rs753796586", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753796586" }, { "id": "rs753796586", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753796586" }, { "id": "rs753796586", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753796586#frequency_tab" }, { "id": "rs753796586", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753796586" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 211, "end_pos": 211, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2357", "site_seq": "", "site_lbl": "N2357", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->IFT).", "chr_id": "12", "chr_pos": "5983161", "evidence": [ { "id": "rs750296925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750296925#frequency_tab" }, { "id": "rs750296925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750296925" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->KFT).", "chr_id": "12", "chr_pos": "5983160", "evidence": [ { "id": "rs765168583", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765168583" }, { "id": "rs765168583", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765168583" }, { "id": "rs765168583", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765168583#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "12", "chr_pos": "5983161", "evidence": [ { "id": "rs750296925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750296925#frequency_tab" }, { "id": "rs750296925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750296925" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "12", "chr_pos": "5983161", "evidence": [ { "id": "rs750296925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750296925" }, { "id": "rs750296925", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750296925#frequency_tab" }, { "id": "rs750296925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750296925" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2357, "end_pos": 2357, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2546", "site_seq": "", "site_lbl": "N2546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->YVS).", "chr_id": "12", "chr_pos": "5969304", "evidence": [ { "id": "rs61751298", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61751298" }, { "id": "rs61751298", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61751298" } ], "disease": [ { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0060573", "name": "von Willebrand's disease 1", "description": "A von Willebrand's disease characterized by quantitative partial deficiency of circulating VWF that has_material_basis_in heterozygous mutation in the VWF gene on chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0060573", "evidence": [ { "id": "0060573", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060573" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] }, { "disease_id": "DOID:0111054", "name": "von Willebrand's disease 3", "description": "A von Willebrand's disease characterized by autosomal recessive inheritance of a severe quantitative defect or virtual absence of VWF in plasma, prolonged bleeding time, and more severe bleeding tendencies compared to the other types of von Willebrand disease that has_material_basis_in homozygous or compound heterozygous mutation in the VWF gene which maps to chromosome 12p13.", "url": "http://disease-ontology.org/term/DOID:0111054", "evidence": [ { "id": "277480", "database": "MIM", "url": "https://www.omim.org/entry/277480" }, { "id": "0111054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111054" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2546, "end_pos": 2546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "2585", "site_seq": "", "site_lbl": "N2585", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "12", "chr_pos": "5968143", "evidence": [ { "id": "rs2136354943", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2136354943" }, { "id": "rs2136354943", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2136354943" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04275-1", "start_pos": 2585, "end_pos": 2585, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2813, "chemical_mass": 309265.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "17", "chr_pos": "66220610", "evidence": [ { "id": "rs758021466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758021466#frequency_tab" }, { "id": "rs758021466", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758021466" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "DTAVFECLPQHAMFGnDTITCTTHGNWTK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "17", "chr_pos": "66220610", "evidence": [ { "id": "rs758021466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758021466" }, { "id": "rs758021466", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758021466#frequency_tab" }, { "id": "rs758021466", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758021466" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02749-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 345, "chemical_mass": 38298.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "KLHINHNnLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "LHINHNNLTESVGPLPK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVnLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "160", "site_seq": "LGSFEGLVNLTFIHLQHNR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFnVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "N", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "LSHNELADSGIPGNSFNVSSLVELDLSYNK", "site_lbl": "Asn252", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "AFEnVTDLQWLILDHNLLENSK", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "88", "site_seq": "N", "site_lbl": "Asn88", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 88, "end_pos": 88, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "12", "chr_pos": "91108600", "evidence": [ { "id": "rs757453748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757453748" }, { "id": "rs757453748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757453748" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "252", "site_seq": "", "site_lbl": "N252", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "12", "chr_pos": "91108224", "evidence": [ { "id": "rs764684672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764684672" }, { "id": "rs764684672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764684672" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "12", "chr_pos": "91108225", "evidence": [ { "id": "rs1880124081", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1880124081" }, { "id": "rs1880124081", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1880124081#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51884-1", "start_pos": 252, "end_pos": 252, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lumican", "gene_name": "LUM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 338, "chemical_mass": 38429.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "5", "chr_pos": "177337491", "evidence": [ { "id": "rs1257503300", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257503300" }, { "id": "rs1257503300", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257503300#frequency_tab" }, { "id": "rs1257503300", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257503300" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNnGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "N", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "VFPYISVMVNNGSLSYDHSK", "site_lbl": "Asn183", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "183", "site_seq": "", "site_lbl": "N183", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "5", "chr_pos": "177337491", "evidence": [ { "id": "rs1257503300", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257503300" }, { "id": "rs1257503300", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257503300#frequency_tab" }, { "id": "rs1257503300", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257503300" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->IGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "5", "chr_pos": "177337490", "evidence": [ { "id": "rs1009847034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009847034" }, { "id": "rs1009847034", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1009847034#frequency_tab" }, { "id": "rs1009847034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1009847034" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q12907-1", "start_pos": 183, "end_pos": 183, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 356, "chemical_mass": 40229.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "10", "chr_pos": "17127864", "evidence": [ { "id": "rs2492161163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2492161163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "", "site_lbl": "N2531", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "10", "chr_pos": "16907620", "evidence": [ { "id": "rs555761842", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs555761842" }, { "id": "rs555761842", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs555761842" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "", "site_lbl": "N781", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "10", "chr_pos": "17071930", "evidence": [ { "id": "rs149758972", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149758972#frequency_tab" }, { "id": "rs149758972", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149758972" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "GSAIGLPQnISSQIYQLNSK", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "N", "site_lbl": "Asn105", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "LCSSVnVSNEIK", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "N", "site_lbl": "Asn2531", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "VCGnGTISHIK", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "N", "site_lbl": "Asn781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "105", "site_seq": "", "site_lbl": "N105", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->DIS).", "chr_id": "10", "chr_pos": "17127864", "evidence": [ { "id": "rs2492161163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2492161163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 105, "end_pos": 105, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "2531", "site_seq": "", "site_lbl": "N2531", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->KVS).", "chr_id": "10", "chr_pos": "16907620", "evidence": [ { "id": "rs555761842", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs555761842" }, { "id": "rs555761842", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs555761842" }, { "id": "rs555761842", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs555761842" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 2531, "end_pos": 2531, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "781", "site_seq": "", "site_lbl": "N781", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "10", "chr_pos": "17071930", "evidence": [ { "id": "rs149758972", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149758972" }, { "id": "rs149758972", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149758972#frequency_tab" }, { "id": "rs149758972", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149758972" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60494-1", "start_pos": 781, "end_pos": 781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cubilin", "gene_name": "CUBN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3623, "chemical_mass": 398736.0 } ] }, { "start_pos": "279", "site_seq": "AnLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "ANLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "AnLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "ANLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "AnLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "ANLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "", "site_lbl": "N279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "16", "chr_pos": "89637534", "evidence": [ { "id": "rs372554004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372554004#frequency_tab" }, { "id": "rs372554004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372554004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "16", "chr_pos": "89637534", "evidence": [ { "id": "rs372554004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372554004#frequency_tab" }, { "id": "rs372554004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372554004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "16", "chr_pos": "89637535", "evidence": [ { "id": "P16444", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16444" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] }, { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "AnLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "ANLSQVADHLDHIK", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "N", "site_lbl": "Asn279", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "VFEAVEQASnLTQAPEEEPIPLDQLGGSCR", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "279", "site_seq": "", "site_lbl": "N279", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "16", "chr_pos": "89637534", "evidence": [ { "id": "rs372554004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372554004#frequency_tab" }, { "id": "rs372554004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372554004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "16", "chr_pos": "89637534", "evidence": [ { "id": "rs372554004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372554004" }, { "id": "rs372554004", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372554004#frequency_tab" }, { "id": "rs372554004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372554004" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "16", "chr_pos": "89637535", "evidence": [ { "id": "P16444", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16444" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] }, { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16444-1", "start_pos": 279, "end_pos": 279, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dipeptidase 1", "gene_name": "DPEP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 411, "chemical_mass": 45674.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "", "site_lbl": "N3780", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "21831665", "evidence": [ { "id": "rs763508790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763508790#frequency_tab" }, { "id": "rs763508790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763508790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "N", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "site_lbl": "Asn3780", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "N", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3836", "site_seq": "IQGEEIVFHDLNLTAHGISHCPTCR", "site_lbl": "Asn3836", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3836, "end_pos": 3836, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "3780", "site_seq": "", "site_lbl": "N3780", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "21831665", "evidence": [ { "id": "rs763508790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763508790" }, { "id": "rs763508790", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763508790#frequency_tab" }, { "id": "rs763508790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763508790" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98160-1", "start_pos": 3780, "end_pos": 3780, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Basement membrane-specific heparan sulfate proteoglycan core protein", "gene_name": "HSPG2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4391, "chemical_mass": 468830.0 } ] }, { "start_pos": "250", "site_seq": "DPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSNVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "GPCGSRDPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSNVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "GPCGSRDPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSNVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "GPCGSRDPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "DPCSNVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "GPCGSRDPCSnVTCSFGSTCAR", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00468-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Agrin", "gene_name": "AGRN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2068, "chemical_mass": 217320.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRnGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "nGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRNGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "NGTGHGNSTHHGPEYMR", "site_lbl": "", "residue": "", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRnGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "nGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRNGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "NGTGHGNSTHHGPEYMR", "site_lbl": "", "residue": "", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRnGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "nGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRNGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "NGTGHGNSTHHGPEYMR", "site_lbl": "", "residue": "", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "", "site_lbl": "N453", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "11", "chr_pos": "6431242", "evidence": [ { "id": "rs768990038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768990038#frequency_tab" }, { "id": "rs768990038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768990038" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "", "site_lbl": "N64", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "6440490", "evidence": [ { "id": "rs138351745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138351745#frequency_tab" }, { "id": "rs138351745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138351745" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRnGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "N", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "nGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "GHGHRNGTGHGNSTHHGPEYMR", "site_lbl": "Asn240", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "240", "site_seq": "NGTGHGNSTHHGPEYMR", "site_lbl": "", "residue": "", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 240, "end_pos": 240, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "ALPQPQnVTSLLGCTH", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "N", "site_lbl": "Asn453", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "CSDGWSFDATTLDDnGTMLFFK", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "N", "site_lbl": "Asn64", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "453", "site_seq": "", "site_lbl": "N453", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "11", "chr_pos": "6431242", "evidence": [ { "id": "rs768990038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768990038#frequency_tab" }, { "id": "rs768990038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768990038" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 453, "end_pos": 453, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "64", "site_seq": "", "site_lbl": "N64", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "6440490", "evidence": [ { "id": "rs138351745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138351745#frequency_tab" }, { "id": "rs138351745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138351745" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02790-1", "start_pos": 64, "end_pos": 64, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 462, "chemical_mass": 51676.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLAnDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "N", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLANDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEInCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEINCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "IYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "RIYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "N", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "DCnATTEFMCNNR", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "DCNATTEFMCNNR", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "N", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "RMLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDANNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "N", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVnTTHRPFDIHVYHPYR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVNTTHR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "N", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLAnDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "N", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLANDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEInCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEINCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "IYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "RIYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "N", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "DCnATTEFMCNNR", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "DCNATTEFMCNNR", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "N", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "RMLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDANNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "N", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVnTTHRPFDIHVYHPYR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVNTTHR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "N", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLAnDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "N", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLANDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEInCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEINCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "IYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "RIYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "N", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "DCnATTEFMCNNR", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "DCNATTEFMCNNR", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "N", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "RMLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDANNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "N", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVnTTHRPFDIHVYHPYR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVNTTHR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "N", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "", "site_lbl": "N1383", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "2", "chr_pos": "169239674", "evidence": [ { "id": "rs1689734706", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1689734706" }, { "id": "rs1689734706", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1689734706#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "2", "chr_pos": "169239673", "evidence": [ { "id": "rs747142179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747142179" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "2", "chr_pos": "169239673", "evidence": [ { "id": "rs747142179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747142179" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "", "site_lbl": "N2499", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "2", "chr_pos": "169206084", "evidence": [ { "id": "rs1688374769", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1688374769" }, { "id": "rs1688374769", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1688374769" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "2", "chr_pos": "169206082", "evidence": [ { "id": "rs764422443", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764422443" }, { "id": "rs764422443", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764422443" }, { "id": "rs764422443", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs764422443#frequency_tab" }, { "id": "rs764422443", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764422443" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "2", "chr_pos": "169206083", "evidence": [ { "id": "P98164", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98164" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "", "site_lbl": "N2781", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "2", "chr_pos": "169201739", "evidence": [ { "id": "rs747432317", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747432317" }, { "id": "rs747432317", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747432317" }, { "id": "rs747432317", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747432317" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "2", "chr_pos": "169201738", "evidence": [ { "id": "rs1054438192", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1054438192" }, { "id": "rs1054438192", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1054438192#frequency_tab" }, { "id": "rs1054438192", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1054438192" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "", "site_lbl": "N2809", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->HNT).", "chr_id": "2", "chr_pos": "169201655", "evidence": [ { "id": "rs768363457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768363457" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169201654", "evidence": [ { "id": "rs191087468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191087468" }, { "id": "rs191087468", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191087468" }, { "id": "rs191087468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs191087468#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "", "site_lbl": "N3315", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "2", "chr_pos": "169182222", "evidence": [ { "id": "rs2545747867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2545747867" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "2", "chr_pos": "169182220", "evidence": [ { "id": "rs201808907", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201808907" }, { "id": "rs201808907", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201808907" }, { "id": "rs201808907", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201808907#frequency_tab" }, { "id": "rs201808907", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201808907" } ], "disease": [ { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169182221", "evidence": [ { "id": "rs772442505", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772442505" }, { "id": "rs772442505", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772442505" }, { "id": "rs772442505", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772442505#frequency_tab" }, { "id": "rs772442505", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772442505" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "", "site_lbl": "N3446", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "2", "chr_pos": "169177858", "evidence": [ { "id": "rs1257823353", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257823353" }, { "id": "rs1257823353", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257823353#frequency_tab" }, { "id": "rs1257823353", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257823353" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLAnDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "N", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "CLCPLGFLLANDSK", "site_lbl": "Asn1383", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEInCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "DSSDEINCTEICLHNEFSCGNGECIPR", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "178", "site_seq": "N", "site_lbl": "Asn178", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 178, "end_pos": 178, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "IYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "RIYYSDYLNQMINSMAEDGSnR", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "N", "site_lbl": "Asn2499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "DCnATTEFMCNNR", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "DCNATTEFMCNNR", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "N", "site_lbl": "Asn2781", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDnNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "EFICNGVDNCHDNNTSDEK", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "N", "site_lbl": "Asn2809", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDEnNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "VCDGILDCPGREDENNTSTGK", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "299", "site_seq": "N", "site_lbl": "Asn299", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 299, "end_pos": 299, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "RMLAQHCVDAnNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "MLAQHCVDANNTFCFDNPR", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "N", "site_lbl": "Asn3315", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVnTTHRPFDIHVYHPYR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "QTLVNTTHR", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "N", "site_lbl": "Asn3446", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "1383", "site_seq": "", "site_lbl": "N1383", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "2", "chr_pos": "169239674", "evidence": [ { "id": "rs1689734706", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1689734706" }, { "id": "rs1689734706", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1689734706#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "2", "chr_pos": "169239673", "evidence": [ { "id": "rs747142179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747142179" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "2", "chr_pos": "169239673", "evidence": [ { "id": "rs747142179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747142179" }, { "id": "rs747142179", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747142179" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 1383, "end_pos": 1383, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2499", "site_seq": "", "site_lbl": "N2499", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "2", "chr_pos": "169206084", "evidence": [ { "id": "rs1688374769", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1688374769" }, { "id": "rs1688374769", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1688374769" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "2", "chr_pos": "169206082", "evidence": [ { "id": "rs764422443", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764422443" }, { "id": "rs764422443", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764422443" }, { "id": "rs764422443", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs764422443#frequency_tab" }, { "id": "rs764422443", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764422443" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "2", "chr_pos": "169206083", "evidence": [ { "id": "P98164", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P98164" } ], "disease": [ { "disease_id": "DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach.", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2499, "end_pos": 2499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2781", "site_seq": "", "site_lbl": "N2781", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "2", "chr_pos": "169201739", "evidence": [ { "id": "rs747432317", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747432317" }, { "id": "rs747432317", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747432317" }, { "id": "rs747432317", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747432317" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "2", "chr_pos": "169201738", "evidence": [ { "id": "rs1054438192", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1054438192" }, { "id": "rs1054438192", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1054438192#frequency_tab" }, { "id": "rs1054438192", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1054438192" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2781, "end_pos": 2781, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "2809", "site_seq": "", "site_lbl": "N2809", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->HNT).", "chr_id": "2", "chr_pos": "169201655", "evidence": [ { "id": "rs768363457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768363457" }, { "id": "rs768363457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768363457" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169201654", "evidence": [ { "id": "rs191087468", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs191087468" }, { "id": "rs191087468", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs191087468" }, { "id": "rs191087468", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs191087468#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 2809, "end_pos": 2809, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3315", "site_seq": "", "site_lbl": "N3315", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).", "chr_id": "2", "chr_pos": "169182222", "evidence": [ { "id": "rs2545747867", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2545747867" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "2", "chr_pos": "169182220", "evidence": [ { "id": "rs201808907", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201808907" }, { "id": "rs201808907", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201808907" }, { "id": "rs201808907", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201808907#frequency_tab" }, { "id": "rs201808907", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201808907" } ], "disease": [ { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] }, { "disease_id": "DOID:0090144", "name": "Donnai-Barrow syndrome", "description": "A syndrome that is characterized by facial and ocular abnormalities, sensorineural hearing loss, agenesis of the corpus callosum, variable intellectual disability, and proteinuria that has_material_basis_in homozygous or compound heterozygous mutation in the LDL receptor related protein 2 gene (LRP2) on chromosome 2q31.", "url": "http://disease-ontology.org/term/DOID:0090144", "evidence": [ { "id": "222448", "database": "MIM", "url": "https://www.omim.org/entry/222448" }, { "id": "0090144", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0090144" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "2", "chr_pos": "169182221", "evidence": [ { "id": "rs772442505", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772442505" }, { "id": "rs772442505", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772442505" }, { "id": "rs772442505", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772442505#frequency_tab" }, { "id": "rs772442505", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772442505" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3315, "end_pos": 3315, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "3446", "site_seq": "", "site_lbl": "N3446", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "2", "chr_pos": "169177858", "evidence": [ { "id": "rs1257823353", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257823353" }, { "id": "rs1257823353", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1257823353#frequency_tab" }, { "id": "rs1257823353", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257823353" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P98164-1", "start_pos": 3446, "end_pos": 3446, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Low-density lipoprotein receptor-related protein 2", "gene_name": "LRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4655, "chemical_mass": 521958.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "YLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "N", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "site_lbl": "Asn271", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "271", "site_seq": "", "site_lbl": "N271", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "14", "chr_pos": "94380977", "evidence": [ { "id": "rs755851961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755851961" }, { "id": "rs755851961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755851961#frequency_tab" }, { "id": "rs755851961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755851961" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01009-1", "start_pos": 271, "end_pos": 271, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 418, "chemical_mass": 46737.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "GRADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "ADDCALPYLGAICYCDLFCnR", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9GZM7-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tubulointerstitial nephritis antigen-like", "gene_name": "TINAGL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 467, "chemical_mass": 52387.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "", "site_lbl": "N367", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "15475571", "evidence": [ { "id": "rs758375344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758375344#frequency_tab" }, { "id": "rs758375344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758375344" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "19", "chr_pos": "15475570", "evidence": [ { "id": "rs752659784", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752659784#frequency_tab" }, { "id": "rs752659784", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752659784" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "LEPVHLQLQCMSQEQLAQVAAnATK", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "N", "site_lbl": "Asn367", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "367", "site_seq": "", "site_lbl": "N367", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "15475571", "evidence": [ { "id": "rs758375344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758375344" }, { "id": "rs758375344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758375344#frequency_tab" }, { "id": "rs758375344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758375344" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "19", "chr_pos": "15475570", "evidence": [ { "id": "rs752659784", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752659784" }, { "id": "rs752659784", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752659784#frequency_tab" }, { "id": "rs752659784", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752659784" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q96PD5-1", "start_pos": 367, "end_pos": 367, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 576, "chemical_mass": 62217.0 } ] }, { "start_pos": "666", "site_seq": "LNLVPGEnITCQDPVIGVGEPGK", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "LNLVPGEnITCQDPVIGVGEPGK", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "LNLVPGEnITCQDPVIGVGEPGK", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "", "site_lbl": "N666", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "6", "chr_pos": "46863090", "evidence": [ { "id": "rs751766229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751766229" }, { "id": "rs751766229", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751766229" }, { "id": "rs751766229", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751766229" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "LNLVPGEnITCQDPVIGVGEPGK", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "N", "site_lbl": "Asn666", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "666", "site_seq": "", "site_lbl": "N666", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "6", "chr_pos": "46863090", "evidence": [ { "id": "rs751766229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751766229" }, { "id": "rs751766229", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751766229" }, { "id": "rs751766229", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751766229" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZF2-1", "start_pos": 666, "end_pos": 666, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Adhesion G protein-coupled receptor F5", "gene_name": "ADGRF5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1346, "chemical_mass": 149457.0 } ] }, { "start_pos": "232", "site_seq": "CNTAAPMWLnGTHPSSDEGIVSR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "CNTAAPMWLnGTHPSSDEGIVSR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "CNTAAPMWLnGTHPSSDEGIVSR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "", "site_lbl": "N232", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "16", "chr_pos": "20348605", "evidence": [ { "id": "rs752681709", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752681709#frequency_tab" }, { "id": "rs752681709", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752681709" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "CNTAAPMWLnGTHPSSDEGIVSR", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "N", "site_lbl": "Asn232", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "232", "site_seq": "", "site_lbl": "N232", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "16", "chr_pos": "20348605", "evidence": [ { "id": "rs752681709", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752681709#frequency_tab" }, { "id": "rs752681709", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752681709" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07911-1", "start_pos": 232, "end_pos": 232, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 640, "chemical_mass": 69761.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVR", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "N", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVRDLKPAIVK", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVR", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "N", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVRDLKPAIVK", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVR", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "N", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVRDLKPAIVK", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "", "site_lbl": "N1424", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "12", "chr_pos": "9068836", "evidence": [ { "id": "rs1212144452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212144452" }, { "id": "rs1212144452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212144452" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVR", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "N", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "VSnQTLSLFFTVLQDVPVRDLKPAIVK", "site_lbl": "Asn1424", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "1424", "site_seq": "", "site_lbl": "N1424", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "12", "chr_pos": "9068836", "evidence": [ { "id": "rs1212144452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212144452" }, { "id": "rs1212144452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212144452" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01023-1", "start_pos": 1424, "end_pos": 1424, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1474, "chemical_mass": 163291.0 } ] }, { "start_pos": "189", "site_seq": "YQFEVLCPAPRPGAASnLSYR", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "N", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "YQFEVLCPAPRPGAASnLSYR", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "N", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "YQFEVLCPAPRPGAASnLSYR", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "N", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "", "site_lbl": "N189", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "14", "chr_pos": "38255458", "evidence": [ { "id": "rs1348541551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1348541551" }, { "id": "rs1348541551", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1348541551" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "14", "chr_pos": "38255458", "evidence": [ { "id": "rs1348541551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1348541551" }, { "id": "rs1348541551", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1348541551" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "14", "chr_pos": "38255456", "evidence": [ { "id": "rs751425995", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751425995" }, { "id": "rs751425995", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751425995" }, { "id": "rs751425995", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751425995" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "14", "chr_pos": "38255457", "evidence": [ { "id": "Q86T13", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q86T13" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "YQFEVLCPAPRPGAASnLSYR", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "N", "site_lbl": "Asn189", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "189", "site_seq": "", "site_lbl": "N189", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "14", "chr_pos": "38255458", "evidence": [ { "id": "rs1348541551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1348541551" }, { "id": "rs1348541551", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1348541551" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "14", "chr_pos": "38255458", "evidence": [ { "id": "rs1348541551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1348541551" }, { "id": "rs1348541551", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1348541551" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "14", "chr_pos": "38255456", "evidence": [ { "id": "rs751425995", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751425995" }, { "id": "rs751425995", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751425995" }, { "id": "rs751425995", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751425995" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "14", "chr_pos": "38255457", "evidence": [ { "id": "Q86T13", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q86T13" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q86T13-1", "start_pos": 189, "end_pos": 189, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C-type lectin domain family 14 member A", "gene_name": "CLEC14A", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 490, "chemical_mass": 51636.0 } ] }, { "start_pos": "2136", "site_seq": "AACAVKPQEVQMVnGTITNPINGK", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "N", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "PQEVQMVNGTITNPINGK", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVnGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVNGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "AACAVKPQEVQMVnGTITNPINGK", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "N", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "PQEVQMVNGTITNPINGK", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVnGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVNGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "AACAVKPQEVQMVnGTITNPINGK", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "N", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "PQEVQMVNGTITNPINGK", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVnGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVNGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "", "site_lbl": "N871", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "6", "chr_pos": "160050569", "evidence": [ { "id": "rs1778172796", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1778172796" }, { "id": "rs1778172796", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1778172796#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "AACAVKPQEVQMVnGTITNPINGK", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "N", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "2136", "site_seq": "PQEVQMVNGTITNPINGK", "site_lbl": "Asn2136", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 2136, "end_pos": 2136, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVnGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "N", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "TGPVVEDSGSLLLEYVNGSACTTSDGR", "site_lbl": "Asn871", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "871", "site_seq": "", "site_lbl": "N871", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "6", "chr_pos": "160050569", "evidence": [ { "id": "rs1778172796", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1778172796" }, { "id": "rs1778172796", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1778172796#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11717-1", "start_pos": 871, "end_pos": 871, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cation-independent mannose-6-phosphate receptor", "gene_name": "IGF2R", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2491, "chemical_mass": 274375.0 } ] }, { "start_pos": "262", "site_seq": "LVMGVPWYGYDYTCLnLSEDHVCTIAK", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "262", "site_seq": "LVMGVPWYGYDYTCLnLSEDHVCTIAK", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "262", "site_seq": "LVMGVPWYGYDYTCLnLSEDHVCTIAK", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "262", "site_seq": "LVMGVPWYGYDYTCLnLSEDHVCTIAK", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "262", "site_seq": "N", "site_lbl": "Asn262", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q01459-1", "start_pos": 262, "end_pos": 262, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Di-N-acetylchitobiase", "gene_name": "CTBS", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 43760.0 } ] }, { "start_pos": "785", "site_seq": "nMTLFSDLVAEK", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "N", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "NMTLFSDLVAEK", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "nMTLFSDLVAEK", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "N", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "NMTLFSDLVAEK", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "nMTLFSDLVAEK", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "N", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "NMTLFSDLVAEK", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "", "site_lbl": "N785", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->HMT).", "chr_id": "21", "chr_pos": "46126168", "evidence": [ { "id": "rs777443196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777443196" }, { "id": "rs777443196", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777443196" }, { "id": "rs777443196", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777443196" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->SMT).", "chr_id": "21", "chr_pos": "46126169", "evidence": [ { "id": "rs746466184", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746466184#frequency_tab" }, { "id": "rs746466184", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746466184" }, { "id": "rs746466184", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs746466184" } ], "disease": [ { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->TMT).", "chr_id": "21", "chr_pos": "46126169", "evidence": [ { "id": "rs746466184", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746466184#frequency_tab" }, { "id": "rs746466184", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746466184" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "nMTLFSDLVAEK", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "N", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "NMTLFSDLVAEK", "site_lbl": "Asn785", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "785", "site_seq": "", "site_lbl": "N785", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->HMT).", "chr_id": "21", "chr_pos": "46126168", "evidence": [ { "id": "rs777443196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777443196" }, { "id": "rs777443196", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777443196" }, { "id": "rs777443196", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777443196" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->SMT).", "chr_id": "21", "chr_pos": "46126169", "evidence": [ { "id": "rs746466184", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746466184#frequency_tab" }, { "id": "rs746466184", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746466184" }, { "id": "rs746466184", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs746466184" } ], "disease": [ { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] }, { "disease_id": "DOID:0050663", "name": "Bethlem myopathy", "description": "A congenital muscular dystrophy that is characterized by myopathy and joint contractures that progresses slowly, has_material_basis_in autosomal dominant inheritance of heterozygous mutation in the COL6A1 gene, the COL6A2 gene, or the COL6A3 gene.", "url": "http://disease-ontology.org/term/DOID:0050663", "evidence": [ { "id": "158810", "database": "MIM", "url": "https://www.omim.org/entry/158810" }, { "id": "0050663", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050663" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->TMT).", "chr_id": "21", "chr_pos": "46126169", "evidence": [ { "id": "rs746466184", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746466184" }, { "id": "rs746466184", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746466184#frequency_tab" }, { "id": "rs746466184", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746466184" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P12110-1", "start_pos": 785, "end_pos": 785, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Collagen alpha-2(VI) chain", "gene_name": "COL6A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1019, "chemical_mass": 108579.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCnETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCNETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLNQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCnETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCNETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLNQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCnETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCNETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLNQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "8", "chr_pos": "27605318", "evidence": [ { "id": "rs1343749062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1343749062" }, { "id": "rs1343749062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1343749062" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "N354", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "8", "chr_pos": "27599882", "evidence": [ { "id": "rs1800687134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1800687134" }, { "id": "rs1800687134", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1800687134" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "N374", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "NC_000008.11", "chr_pos": "27599822", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCnETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "N", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "ELPGVCNETMMALWEECKPCLK", "site_lbl": "Asn103", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "N", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLnQSSPFYFWMNGDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "QLEEFLNQSSPFYFWMNGDRIDSLLENDR", "site_lbl": "Asn145", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLnTSSLLEQLNEQFNWVSR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "N", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR", "site_lbl": "Asn354", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LAnLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "N", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "LANLTQGEDQYYLR", "site_lbl": "Asn374", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "N145", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "8", "chr_pos": "27605318", "evidence": [ { "id": "rs1343749062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1343749062" }, { "id": "rs1343749062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1343749062" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "N354", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "8", "chr_pos": "27599882", "evidence": [ { "id": "rs1800687134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1800687134" }, { "id": "rs1800687134", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1800687134" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "N374", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "NC_000008.11", "chr_pos": "27599822", "evidence": [] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "103", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of beta chain; when associated with Q-86 and Q-145.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 103, "end_pos": 103, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "145", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of beta chain; when associated with Q-86 and Q-103.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 145, "end_pos": 145, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "354", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-374. Decreases secretion; when associated with Q-291 and Q-374.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 354, "end_pos": 354, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "374", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-354. Decreases secretion; when associated with Q-291 and Q-354.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprotkb/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P10909-1", "start_pos": 374, "end_pos": 374, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 449, "chemical_mass": 52495.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGnQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGNQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "N", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGnQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGNQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "N", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGnQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGNQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "N", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "", "site_lbl": "N227", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "8", "chr_pos": "73067456", "evidence": [ { "id": "rs773889462", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773889462" }, { "id": "rs773889462", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773889462" }, { "id": "rs773889462", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773889462#frequency_tab" }, { "id": "rs773889462", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773889462" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGnQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "CSGDGLDSDGNQTLHWQAIGNPR", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "N", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "227", "site_seq": "", "site_lbl": "N227", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->TQT).", "chr_id": "8", "chr_pos": "73067456", "evidence": [ { "id": "rs773889462", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773889462" }, { "id": "rs773889462", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773889462" }, { "id": "rs773889462", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773889462#frequency_tab" }, { "id": "rs773889462", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773889462" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IVN8-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Somatomedin-B and thrombospondin type-1 domain-containing protein", "gene_name": "SBSPON", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 264, "chemical_mass": 29610.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "", "site_lbl": "N248", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "15", "chr_pos": "39584027", "evidence": [ { "id": "rs1890162753", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1890162753" }, { "id": "rs1890162753", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1890162753#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVnGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "N", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "GCSSSTSVLLTLDNNVVNGSSPAIR", "site_lbl": "Asn248", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "KVSCPIMPCSnATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "VSCPIMPCSNATVPDGECCPR", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "248", "site_seq": "", "site_lbl": "N248", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "15", "chr_pos": "39584027", "evidence": [ { "id": "rs1890162753", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1890162753" }, { "id": "rs1890162753", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1890162753#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 248, "end_pos": 248, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "disease": [ { "disease_id": "DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells.", "url": "http://disease-ontology.org/term/DOID:4159", "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P07996-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1170, "chemical_mass": 129383.0 } ] }, { "start_pos": "174", "site_seq": "IVDVnLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "N", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "IVDVNLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "IVDVnLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "N", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "IVDVNLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "IVDVnLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "N", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "IVDVNLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "IVDVnLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "N", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "174", "site_seq": "IVDVNLTSEGK", "site_lbl": "Asn174", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HD45-1", "start_pos": 174, "end_pos": 174, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane 9 superfamily member 3", "gene_name": "TM9SF3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 589, "chemical_mass": 67888.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "", "site_lbl": "N205", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" }, { "id": "rs768936464", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768936464" }, { "id": "rs768936464", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs768936464" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "N", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "ITYSIVQTnCSKENFLFLTPDCK", "site_lbl": "Asn205", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "205", "site_seq": "", "site_lbl": "N205", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->ICS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" }, { "id": "rs768936464", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768936464" }, { "id": "rs768936464", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768936464" }, { "id": "rs768936464", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs768936464" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "3", "chr_pos": "186727286", "evidence": [ { "id": "P01042", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01042" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01042-1", "start_pos": 205, "end_pos": 205, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 644, "chemical_mass": 71957.0 } ] }, { "start_pos": "3333", "site_seq": "TCVSnCTASQFVCK", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "N", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "TCVSNCTASQFVCK", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "TCVSnCTASQFVCK", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "N", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "TCVSNCTASQFVCK", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "TCVSnCTASQFVCK", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "N", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "TCVSNCTASQFVCK", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "TCVSnCTASQFVCK", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "N", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "3333", "site_seq": "TCVSNCTASQFVCK", "site_lbl": "Asn3333", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07954-1", "start_pos": 3333, "end_pos": 3333, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4544, "chemical_mass": 504606.0 } ] }, { "start_pos": "362", "site_seq": "IQFInQTETPIQTTFTMSLLGTK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "362", "site_seq": "IQFInQTETPIQTTFTMSLLGTK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "362", "site_seq": "IQFInQTETPIQTTFTMSLLGTK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "362", "site_seq": "", "site_lbl": "N362", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "15", "chr_pos": "58560897", "evidence": [ { "id": "rs1266590486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1266590486" }, { "id": "rs1266590486", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1266590486" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "362", "site_seq": "IQFInQTETPIQTTFTMSLLGTK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "362", "site_seq": "", "site_lbl": "N362", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "15", "chr_pos": "58560897", "evidence": [ { "id": "rs1266590486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1266590486" }, { "id": "rs1266590486", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1266590486" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11150-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 499, "chemical_mass": 55914.0 } ] }, { "start_pos": "1323", "site_seq": "VILILDPAISGnETQPYPAFTR", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "N", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "VILILDPAISGnETQPYPAFTR", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "N", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "VILILDPAISGnETQPYPAFTR", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "N", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "VILILDPAISGnETQPYPAFTR", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "1323", "site_seq": "N", "site_lbl": "Asn1323", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O43451-2", "start_pos": 1323, "end_pos": 1323, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Maltase-glucoamylase", "gene_name": "MGAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2753, "chemical_mass": 312022.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "7", "chr_pos": "99971758", "evidence": [ { "id": "rs147067825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147067825#frequency_tab" }, { "id": "rs147067825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147067825" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "7", "chr_pos": "99971757", "evidence": [ { "id": "rs1305659520", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305659520" }, { "id": "rs1305659520", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1305659520" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "7", "chr_pos": "99971747", "evidence": [ { "id": "rs200393898", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200393898#frequency_tab" }, { "id": "rs200393898", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200393898" }, { "id": "rs141506204", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141506204" }, { "id": "rs141506204", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141506204#frequency_tab" }, { "id": "rs141506204", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141506204" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "7", "chr_pos": "99971748", "evidence": [ { "id": "rs1454741051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1454741051" }, { "id": "rs1454741051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1454741051#frequency_tab" }, { "id": "rs1454741051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1454741051" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "DIVEYYnDSNGSHVLQGR", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "N", "site_lbl": "Asn109", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "109", "site_seq": "", "site_lbl": "N109", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->DDS).", "chr_id": "7", "chr_pos": "99971758", "evidence": [ { "id": "rs147067825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147067825" }, { "id": "rs147067825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147067825#frequency_tab" }, { "id": "rs147067825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147067825" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->IDS).", "chr_id": "7", "chr_pos": "99971757", "evidence": [ { "id": "rs1305659520", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305659520" }, { "id": "rs1305659520", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1305659520" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "7", "chr_pos": "99971747", "evidence": [ { "id": "rs200393898", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200393898" }, { "id": "rs200393898", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200393898#frequency_tab" }, { "id": "rs200393898", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200393898" }, { "id": "rs141506204", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141506204" }, { "id": "rs141506204", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141506204" }, { "id": "rs141506204", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141506204#frequency_tab" }, { "id": "rs141506204", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141506204" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "7", "chr_pos": "99971748", "evidence": [ { "id": "rs1454741051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1454741051" }, { "id": "rs1454741051", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1454741051#frequency_tab" }, { "id": "rs1454741051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1454741051" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25311-1", "start_pos": 109, "end_pos": 109, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 298, "chemical_mass": 34259.0 } ] }, { "start_pos": "146", "site_seq": "RNPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "NPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "RNPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "NPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "RNPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "NPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "", "site_lbl": "N146", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->THS).", "chr_id": "1", "chr_pos": "22639106", "evidence": [ { "id": "rs2148291146", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2148291146" }, { "id": "rs2148291146", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2148291146" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "RNPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "NPPMGGNVVIFDTVITNQEEPYQnHSGR", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "N", "site_lbl": "Asn146", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "146", "site_seq": "", "site_lbl": "N146", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->THS).", "chr_id": "1", "chr_pos": "22639106", "evidence": [ { "id": "rs2148291146", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2148291146" }, { "id": "rs2148291146", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2148291146" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02745-1", "start_pos": 146, "end_pos": 146, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 245, "chemical_mass": 26017.0 } ] }, { "start_pos": "160", "site_seq": "NYLGEAVSHnASLEVAILR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "NYLGEAVSHNASLEVAILR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "NYLGEAVSHnASLEVAILR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "NYLGEAVSHNASLEVAILR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "NYLGEAVSHnASLEVAILR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "NYLGEAVSHNASLEVAILR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "", "site_lbl": "N160", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->DAS).", "chr_id": "3", "chr_pos": "78938622", "evidence": [ { "id": "rs749077908", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749077908" }, { "id": "rs749077908", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749077908" }, { "id": "rs749077908", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749077908" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "3", "chr_pos": "78938621", "evidence": [ { "id": "rs779895003", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779895003" }, { "id": "rs779895003", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779895003" }, { "id": "rs779895003", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs779895003#frequency_tab" }, { "id": "rs779895003", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779895003" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "NYLGEAVSHnASLEVAILR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "NYLGEAVSHNASLEVAILR", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "N", "site_lbl": "Asn160", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "160", "site_seq": "", "site_lbl": "N160", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->DAS).", "chr_id": "3", "chr_pos": "78938622", "evidence": [ { "id": "rs749077908", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749077908" }, { "id": "rs749077908", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749077908" }, { "id": "rs749077908", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749077908" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "3", "chr_pos": "78938621", "evidence": [ { "id": "rs779895003", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779895003" }, { "id": "rs779895003", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779895003" }, { "id": "rs779895003", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs779895003#frequency_tab" }, { "id": "rs779895003", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779895003" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y6N7-1", "start_pos": 160, "end_pos": 160, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Roundabout homolog 1", "gene_name": "ROBO1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1651, "chemical_mass": 180930.0 } ] }, { "start_pos": "350", "site_seq": "AQEAPGTnGSLVLATPGAGARPEPDSLQAR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "AQEAPGTNGSLVLATPGAGAR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "N", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "AQEAPGTnGSLVLATPGAGARPEPDSLQAR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "AQEAPGTNGSLVLATPGAGAR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "N", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "AQEAPGTnGSLVLATPGAGARPEPDSLQAR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "AQEAPGTNGSLVLATPGAGAR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "N", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "", "site_lbl": "N350", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "10", "chr_pos": "86943736", "evidence": [ { "id": "rs1844020028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1844020028" }, { "id": "rs1844020028", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1844020028" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "10", "chr_pos": "86943735", "evidence": [ { "id": "rs768730692", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768730692" }, { "id": "rs768730692", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768730692" }, { "id": "rs768730692", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768730692" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "AQEAPGTnGSLVLATPGAGARPEPDSLQAR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "AQEAPGTNGSLVLATPGAGAR", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "N", "site_lbl": "Asn350", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "350", "site_seq": "", "site_lbl": "N350", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "10", "chr_pos": "86943736", "evidence": [ { "id": "rs1844020028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1844020028" }, { "id": "rs1844020028", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1844020028" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "10", "chr_pos": "86943735", "evidence": [ { "id": "rs768730692", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768730692" }, { "id": "rs768730692", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768730692" }, { "id": "rs768730692", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768730692" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9H8L6-1", "start_pos": 350, "end_pos": 350, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Multimerin-2", "gene_name": "MMRN2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 949, "chemical_mass": 104409.0 } ] }, { "start_pos": "1986", "site_seq": "SRnSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "nSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "NSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "N", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "SRnSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "nSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "NSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "N", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "SRnSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "nSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "NSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "N", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "", "site_lbl": "N1986", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "11", "chr_pos": "121621130", "evidence": [ { "id": "rs1863717703", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1863717703" }, { "id": "rs1863717703", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1863717703" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "SRnSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "nSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "NSTVEYTLNK", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "N", "site_lbl": "Asn1986", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "1986", "site_seq": "", "site_lbl": "N1986", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "11", "chr_pos": "121621130", "evidence": [ { "id": "rs1863717703", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1863717703" }, { "id": "rs1863717703", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1863717703" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92673-1", "start_pos": 1986, "end_pos": 1986, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sortilin-related receptor", "gene_name": "SORL1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2214, "chemical_mass": 248426.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDnTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDNTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDnTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDNTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDnTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDNTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "19", "chr_pos": "49514258", "evidence": [ { "id": "rs977467479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs977467479" }, { "id": "rs977467479", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs977467479" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->HTS).", "chr_id": "19", "chr_pos": "49514258", "evidence": [ { "id": "rs977467479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs977467479" }, { "id": "rs977467479", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs977467479" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "19", "chr_pos": "49514259", "evidence": [ { "id": "rs758794510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758794510" }, { "id": "rs758794510", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758794510" }, { "id": "rs758794510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758794510#frequency_tab" }, { "id": "rs758794510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758794510" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDnTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "GPYTLQGLLGCELGPDNTSVPTAK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "19", "chr_pos": "49514258", "evidence": [ { "id": "rs977467479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs977467479" }, { "id": "rs977467479", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs977467479" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->HTS).", "chr_id": "19", "chr_pos": "49514258", "evidence": [ { "id": "rs977467479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs977467479" }, { "id": "rs977467479", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs977467479" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "19", "chr_pos": "49514259", "evidence": [ { "id": "rs758794510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758794510" }, { "id": "rs758794510", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758794510" }, { "id": "rs758794510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758794510#frequency_tab" }, { "id": "rs758794510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758794510" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P55899-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "IgG receptor FcRn large subunit p51", "gene_name": "FCGRT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 365, "chemical_mass": 39743.0 } ] }, { "start_pos": "362", "site_seq": "AQVIInITDVDEPPIFQQPFYHFQLK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "ELDREVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "EVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "N", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "362", "site_seq": "AQVIInITDVDEPPIFQQPFYHFQLK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "ELDREVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "EVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "N", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "362", "site_seq": "AQVIInITDVDEPPIFQQPFYHFQLK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "ELDREVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "EVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "N", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "362", "site_seq": "AQVIInITDVDEPPIFQQPFYHFQLK", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "362", "site_seq": "N", "site_lbl": "Asn362", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 362, "end_pos": 362, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "ELDREVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "EVYPWYnLTVEAK", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "442", "site_seq": "N", "site_lbl": "Asn442", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P33151-1", "start_pos": 442, "end_pos": 442, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 784, "chemical_mass": 87528.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "", "site_lbl": "N430", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT); n-glyco-sequon-gain (NHN->NHS).", "chr_id": "2", "chr_pos": "215423454", "evidence": [ { "id": "rs747033490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747033490#frequency_tab" }, { "id": "rs747033490", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747033490" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "", "site_lbl": "N1007", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "215404622", "evidence": [ { "id": "rs145838840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145838840#frequency_tab" }, { "id": "rs145838840", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145838840" } ], "disease": [ { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "215404623", "evidence": [ { "id": "rs768650910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768650910" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "2", "chr_pos": "215420764", "evidence": [ { "id": "rs528350304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528350304#frequency_tab" }, { "id": "rs528350304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528350304" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "", "site_lbl": "N542", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "2", "chr_pos": "215420724", "evidence": [ { "id": "rs749189506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749189506" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "2", "chr_pos": "215420722", "evidence": [ { "id": "rs138144264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138144264" }, { "id": "rs138144264", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138144264#frequency_tab" }, { "id": "rs138144264", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138144264" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "2", "chr_pos": "215420723", "evidence": [ { "id": "rs576328100", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576328100" }, { "id": "rs576328100", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576328100" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVnETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "N", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "LDAPTNLQFVNETDSTVLVR", "site_lbl": "Asn1007", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGRR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHnYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "N", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "GGNSNGALCHFPFLYNNHNYTDCTSEGR", "site_lbl": "Asn430", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "N", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVNDTFHK", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "DQCIVDDITYNVnDTFHKR", "site_lbl": "Asn528", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "RHEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "N", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLnCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "HEEGHMLNCTCFGQGR", "site_lbl": "Asn542", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "430", "site_seq": "", "site_lbl": "N430", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT); n-glyco-sequon-gain (NHN->NHS).", "chr_id": "2", "chr_pos": "215423454", "evidence": [ { "id": "rs747033490", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747033490" }, { "id": "rs747033490", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747033490#frequency_tab" }, { "id": "rs747033490", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747033490" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 430, "end_pos": 430, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "1007", "site_seq": "", "site_lbl": "N1007", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "2", "chr_pos": "215404622", "evidence": [ { "id": "rs145838840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145838840" }, { "id": "rs145838840", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145838840#frequency_tab" }, { "id": "rs145838840", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145838840" } ], "disease": [ { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] }, { "disease_id": "DOID:0112297", "name": "spondylometaphyseal dysplasia corner fracture type", "description": "A spondylometaphyseal dysplasia characterized by flake-like, triangular, or curvilinear ossification centers at the edges of irregular metaphyses that simulate fractures that has_material_basis_in heterozygous mutation in FN1 on chromosome 2q35.", "url": "http://disease-ontology.org/term/DOID:0112297", "evidence": [ { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" }, { "id": "0112297", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112297" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "2", "chr_pos": "215404623", "evidence": [ { "id": "rs768650910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768650910" }, { "id": "rs768650910", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768650910" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 1007, "end_pos": 1007, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "528", "site_seq": "", "site_lbl": "N528", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "2", "chr_pos": "215420764", "evidence": [ { "id": "rs528350304", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528350304" }, { "id": "rs528350304", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528350304#frequency_tab" }, { "id": "rs528350304", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528350304" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 528, "end_pos": 528, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "542", "site_seq": "", "site_lbl": "N542", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "2", "chr_pos": "215420724", "evidence": [ { "id": "rs749189506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749189506" }, { "id": "rs749189506", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749189506" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "2", "chr_pos": "215420722", "evidence": [ { "id": "rs138144264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138144264" }, { "id": "rs138144264", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138144264" }, { "id": "rs138144264", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138144264#frequency_tab" }, { "id": "rs138144264", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138144264" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "2", "chr_pos": "215420723", "evidence": [ { "id": "rs576328100", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs576328100" }, { "id": "rs576328100", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs576328100" }, { "id": "rs576328100", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs576328100" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02751-15", "start_pos": 542, "end_pos": 542, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibronectin", "gene_name": "FN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 2477, "chemical_mass": 272320.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPnYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "N", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPNYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WnNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "N", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WNNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPnYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "N", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPNYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WnNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "N", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WNNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPnYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "N", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPNYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WnNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "N", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WNNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "", "site_lbl": "N186", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "1", "chr_pos": "206937582", "evidence": [ { "id": "rs1487109329", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1487109329" }, { "id": "rs1487109329", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1487109329" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "", "site_lbl": "N469", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "1", "chr_pos": "206934719", "evidence": [ { "id": "rs767674762", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767674762#frequency_tab" }, { "id": "rs767674762", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767674762" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPnYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "N", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "QIGLYPVLVIDSSGYVNPNYTGR", "site_lbl": "Asn186", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "VPGnVTAVLGETLK", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "N", "site_lbl": "Asn469", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WnNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "N", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "499", "site_seq": "WNNTGCQALPSQDEGPSK", "site_lbl": "Asn499", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 499, "end_pos": 499, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "186", "site_seq": "", "site_lbl": "N186", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "1", "chr_pos": "206937582", "evidence": [ { "id": "rs1487109329", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1487109329" }, { "id": "rs1487109329", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1487109329" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 186, "end_pos": 186, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "469", "site_seq": "", "site_lbl": "N469", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "1", "chr_pos": "206934719", "evidence": [ { "id": "rs767674762", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767674762" }, { "id": "rs767674762", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767674762#frequency_tab" }, { "id": "rs767674762", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767674762" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01833-1", "start_pos": 469, "end_pos": 469, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Polymeric immunoglobulin receptor", "gene_name": "PIGR", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 83284.0 } ] }, { "start_pos": "551", "site_seq": "EGICNGFTALCPASDPKPnFTDCNR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "PNFTDCNR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "EGICNGFTALCPASDPKPnFTDCNR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "PNFTDCNR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "EGICNGFTALCPASDPKPnFTDCNR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "PNFTDCNR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "EGICNGFTALCPASDPKPnFTDCNR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "PNFTDCNR", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "551", "site_seq": "N", "site_lbl": "Asn551", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O14672-1", "start_pos": 551, "end_pos": 551, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 748, "chemical_mass": 84142.0 } ] }, { "start_pos": "1068", "site_seq": "VVFLSPAVPEEPEAYnLTVLIEMDGHR", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "VVFLSPAVPEEPEAYNLTVLIEMDGHR", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "N", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "VVFLSPAVPEEPEAYnLTVLIEMDGHR", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "VVFLSPAVPEEPEAYNLTVLIEMDGHR", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "N", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "VVFLSPAVPEEPEAYnLTVLIEMDGHR", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "VVFLSPAVPEEPEAYNLTVLIEMDGHR", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "N", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "VVFLSPAVPEEPEAYnLTVLIEMDGHR", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "VVFLSPAVPEEPEAYNLTVLIEMDGHR", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1068", "site_seq": "N", "site_lbl": "Asn1068", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1068, "end_pos": 1068, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFEnFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "TEAGAFEYVPDPTFENFTGGVK", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "1099", "site_seq": "N", "site_lbl": "Asn1099", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15031-1", "start_pos": 1099, "end_pos": 1099, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plexin-B2", "gene_name": "PLXNB2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1838, "chemical_mass": 205127.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "", "site_lbl": "N324", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "4", "chr_pos": "110506688", "evidence": [ { "id": "rs1357172069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357172069" }, { "id": "rs1357172069", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357172069" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAAnITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "HTAEYAANITK", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "N", "site_lbl": "Asn324", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "324", "site_seq": "", "site_lbl": "N324", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "4", "chr_pos": "110506688", "evidence": [ { "id": "rs1357172069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357172069" }, { "id": "rs1357172069", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357172069" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "4", "chr_pos": "110506689", "evidence": [ { "id": "rs897327471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs897327471" }, { "id": "rs897327471", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs897327471" }, { "id": "rs897327471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs897327471" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q07075-1", "start_pos": 324, "end_pos": 324, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Glutamyl aminopeptidase", "gene_name": "ENPEP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 957, "chemical_mass": 109244.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "EVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "N", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "IFLKEVnDTLLVNELK", "site_lbl": "Asn599", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "599", "site_seq": "", "site_lbl": "N599", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "13", "chr_pos": "37579117", "evidence": [ { "id": "rs371116902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371116902" }, { "id": "rs371116902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371116902#frequency_tab" }, { "id": "rs371116902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371116902" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15063-1", "start_pos": 599, "end_pos": 599, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Periostin", "gene_name": "POSTN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 836, "chemical_mass": 93314.0 } ] }, { "start_pos": "227", "site_seq": "DnLTLWTSDMQGDGEEQNK", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P62258-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 29174.0 } ] }, { "start_pos": "227", "site_seq": "DNLTLWTSDMQGDGEEQNK", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P62258-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 29174.0 } ] }, { "start_pos": "227", "site_seq": "DnLTLWTSDMQGDGEEQNK", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P62258-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 29174.0 } ] }, { "start_pos": "227", "site_seq": "DNLTLWTSDMQGDGEEQNK", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P62258-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 29174.0 } ] }, { "start_pos": "227", "site_seq": "DnLTLWTSDMQGDGEEQNK", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P62258-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 29174.0 } ] }, { "start_pos": "227", "site_seq": "DNLTLWTSDMQGDGEEQNK", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P62258-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 29174.0 } ] }, { "start_pos": "227", "site_seq": "DnLTLWTSDMQGDGEEQNK", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P62258-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 29174.0 } ] }, { "start_pos": "227", "site_seq": "DNLTLWTSDMQGDGEEQNK", "site_lbl": "Asn227", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P62258-1", "start_pos": 227, "end_pos": 227, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 255, "chemical_mass": 29174.0 } ] }, { "start_pos": "194", "site_seq": "LTQGICLEQnK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "194", "site_seq": "LTQGICLEQnK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "194", "site_seq": "LTQGICLEQnK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "194", "site_seq": "LTQGICLEQnK", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "194", "site_seq": "N", "site_lbl": "Asn194", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P28906-1", "start_pos": 194, "end_pos": 194, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Hematopoietic progenitor cell antigen CD34", "gene_name": "CD34", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 385, "chemical_mass": 40716.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFKFDTISEK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "SLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "LFGDKSLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFKFDTISEK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "SLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "LFGDKSLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFKFDTISEK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "SLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "LFGDKSLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->YDT).", "chr_id": "1", "chr_pos": "173914579", "evidence": [ { "id": "rs1657908048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657908048" }, { "id": "rs1657908048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1657908048" } ], "disease": [ { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] }, { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "1", "chr_pos": "173911863", "evidence": [ { "id": "rs1657783494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657783494" }, { "id": "rs1657783494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1657783494#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "N", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "LGACnDTLQQLMEVFKFDTISEK", "site_lbl": "Asn128", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "SLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "N", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "LFGDKSLTFnETYQDISELVYGAK", "site_lbl": "Asn187", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "128", "site_seq": "", "site_lbl": "N128", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->YDT).", "chr_id": "1", "chr_pos": "173914579", "evidence": [ { "id": "rs1657908048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657908048" }, { "id": "rs1657908048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1657908048" } ], "disease": [ { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] }, { "disease_id": "DOID:3755", "name": "antithrombin III deficiency", "description": "A thrombophilia that is characterized by the tendency to form clots in the veins.", "url": "http://disease-ontology.org/term/DOID:3755", "evidence": [ { "id": "613118", "database": "MIM", "url": "https://www.omim.org/entry/613118" }, { "id": "3755", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3755" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 128, "end_pos": 128, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "187", "site_seq": "", "site_lbl": "N187", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "1", "chr_pos": "173911863", "evidence": [ { "id": "rs1657783494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1657783494" }, { "id": "rs1657783494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1657783494#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01008-1", "start_pos": 187, "end_pos": 187, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 464, "chemical_mass": 52602.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "72060219", "evidence": [ { "id": "rs375137689", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375137689#frequency_tab" }, { "id": "rs375137689", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375137689" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "MVSHHnLTTGATLINEQWLLTTAK", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "N", "site_lbl": "Asn184", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "N", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "QLVEIEKVVLHPnYSQVDIGLIK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "VVLHPnYSQVDIGLIKLK", "site_lbl": "Asn241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "184", "site_seq": "", "site_lbl": "N184", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "72060219", "evidence": [ { "id": "rs375137689", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375137689" }, { "id": "rs375137689", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375137689#frequency_tab" }, { "id": "rs375137689", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375137689" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 184, "end_pos": 184, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "241", "site_seq": "", "site_lbl": "N241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).", "chr_id": "16", "chr_pos": "72060390", "evidence": [ { "id": "rs2041524054", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524054" }, { "id": "rs2041524054", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2041524054#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->IYS).", "chr_id": "16", "chr_pos": "72060391", "evidence": [ { "id": "rs2041524101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2041524101" }, { "id": "rs2041524101", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2041524101" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00738-1", "start_pos": 241, "end_pos": 241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Haptoglobin", "gene_name": "HP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 406, "chemical_mass": 45205.0 } ] }, { "start_pos": "124", "site_seq": "nLTVCPDGALFEQK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "PYTLEEQKNLTVCPDGALFEQK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "nLTVCPDGALFEQK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "PYTLEEQKNLTVCPDGALFEQK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "nLTVCPDGALFEQK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "PYTLEEQKNLTVCPDGALFEQK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "", "site_lbl": "N124", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "141913676", "evidence": [ { "id": "rs1934406915", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1934406915" }, { "id": "rs1934406915", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1934406915" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "nLTVCPDGALFEQK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "PYTLEEQKNLTVCPDGALFEQK", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "124", "site_seq": "", "site_lbl": "N124", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "141913676", "evidence": [ { "id": "rs1934406915", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1934406915" }, { "id": "rs1934406915", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1934406915" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P54709-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 279, "chemical_mass": 31513.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTnLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTNLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTnLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTNLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTnLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTNLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "N170", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "19", "chr_pos": "6586092", "evidence": [ { "id": "rs147009720", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147009720" }, { "id": "rs147009720", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147009720" }, { "id": "rs147009720", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147009720#frequency_tab" }, { "id": "rs147009720", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147009720" }, { "id": "rs147009720", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs147009720" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTnLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "GDTLCTNLTGTLLPSR", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "N", "site_lbl": "Asn170", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "N170", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "19", "chr_pos": "6586092", "evidence": [ { "id": "rs147009720", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147009720" }, { "id": "rs147009720", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147009720" }, { "id": "rs147009720", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147009720#frequency_tab" }, { "id": "rs147009720", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147009720" }, { "id": "rs147009720", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs147009720" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "170", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreased expression and decreased binding to CD27.", "evidence": [ { "database": "UniProtKB", "id": "P32970", "url": "https://www.uniprot.org/uniprotkb/P32970" }, { "database": "PubMed", "id": "34419446", "url": "https://glygen.org/publication/PubMed/34419446" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P32970-1", "start_pos": 170, "end_pos": 170, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD70 antigen", "gene_name": "CD70", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 193, "chemical_mass": 21118.0 } ] }, { "start_pos": "121", "site_seq": "ITNnQTGQMVFSETVITSVGDEEGRR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBP4-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 38390.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBP4-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 38390.0 } ] }, { "start_pos": "121", "site_seq": "ITNnQTGQMVFSETVITSVGDEEGRR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBP4-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 38390.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBP4-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 38390.0 } ] }, { "start_pos": "121", "site_seq": "ITNnQTGQMVFSETVITSVGDEEGRR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBP4-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 38390.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBP4-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 38390.0 } ] }, { "start_pos": "121", "site_seq": "", "site_lbl": "N121", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "11", "chr_pos": "11998770", "evidence": [ { "id": "rs2133323497", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133323497" }, { "id": "rs2133323497", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2133323497" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "11", "chr_pos": "11998769", "evidence": [ { "id": "rs1221263732", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1221263732" }, { "id": "rs1221263732", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1221263732#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBP4-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 38390.0 } ] }, { "start_pos": "121", "site_seq": "ITNnQTGQMVFSETVITSVGDEEGRR", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBP4-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 38390.0 } ] }, { "start_pos": "121", "site_seq": "N", "site_lbl": "Asn121", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBP4-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 38390.0 } ] }, { "start_pos": "121", "site_seq": "", "site_lbl": "N121", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "11", "chr_pos": "11998770", "evidence": [ { "id": "rs2133323497", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2133323497" }, { "id": "rs2133323497", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2133323497" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "11", "chr_pos": "11998769", "evidence": [ { "id": "rs1221263732", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1221263732" }, { "id": "rs1221263732", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1221263732#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBP4-1", "start_pos": 121, "end_pos": 121, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 350, "chemical_mass": 38390.0 } ] }, { "start_pos": "285", "site_seq": "IVLDPSGSMNIYLVLDGSDSIGASnFTGAK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnRTR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "IVLDPSGSMNIYLVLDGSDSIGASnFTGAK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnRTR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "IVLDPSGSMNIYLVLDGSDSIGASnFTGAK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnRTR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "6", "chr_pos": "31948038", "evidence": [ { "id": "rs2482685674", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2482685674" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "6", "chr_pos": "31948926", "evidence": [ { "id": "rs757587163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757587163" }, { "id": "rs757587163", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757587163" }, { "id": "rs757587163", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757587163" }, { "id": "rs757587163", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs757587163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "IVLDPSGSMNIYLVLDGSDSIGASnFTGAK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "N", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "ALQAVYSMMSWPDDVPPEGWnRTR", "site_lbl": "Asn378", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "6", "chr_pos": "31948038", "evidence": [ { "id": "rs2482685674", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2482685674" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "378", "site_seq": "", "site_lbl": "N378", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->TRT).", "chr_id": "6", "chr_pos": "31948926", "evidence": [ { "id": "rs757587163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757587163" }, { "id": "rs757587163", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757587163" }, { "id": "rs757587163", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757587163" }, { "id": "rs757587163", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs757587163" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00751-1", "start_pos": 378, "end_pos": 378, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor B", "gene_name": "CFB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 764, "chemical_mass": 85533.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "N", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "78", "site_seq": "DLQSLEDILHQVEnKTSEVK", "site_lbl": "Asn78", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02679-1", "start_pos": 78, "end_pos": 78, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 453, "chemical_mass": 51512.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "3", "chr_pos": "52782190", "evidence": [ { "id": "rs1370350537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1370350537" }, { "id": "rs1370350537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1370350537" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "3", "chr_pos": "52782191", "evidence": [ { "id": "rs2154108330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2154108330" }, { "id": "rs2154108330", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2154108330" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "ICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "DKICDLLVANNHFAHFFAPQnLTNMNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "3", "chr_pos": "52782190", "evidence": [ { "id": "rs1370350537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1370350537" }, { "id": "rs1370350537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1370350537" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "3", "chr_pos": "52782191", "evidence": [ { "id": "rs2154108330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2154108330" }, { "id": "rs2154108330", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2154108330" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19827-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 911, "chemical_mass": 101389.0 } ] }, { "start_pos": "2019", "site_seq": "CEICAPGFYGNALLPGnCTR", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "N", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "CEICAPGFYGNALLPGNCTR", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "LVEAAEAHAQQLGQLALnLSSIILDVNQDR", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "LVEAAEAHAQQLGQLALNLSSIILDVNQDR", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "N", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "AQQLLAnSTALEEAMLQEQQR", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "N", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "AQQLLANSTALEEAMLQEQQR", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "CEICAPGFYGNALLPGnCTR", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "N", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "CEICAPGFYGNALLPGNCTR", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "LVEAAEAHAQQLGQLALnLSSIILDVNQDR", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "LVEAAEAHAQQLGQLALNLSSIILDVNQDR", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "N", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "AQQLLAnSTALEEAMLQEQQR", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "N", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "AQQLLANSTALEEAMLQEQQR", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "CEICAPGFYGNALLPGnCTR", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "N", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "CEICAPGFYGNALLPGNCTR", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "LVEAAEAHAQQLGQLALnLSSIILDVNQDR", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "LVEAAEAHAQQLGQLALNLSSIILDVNQDR", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "N", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "AQQLLAnSTALEEAMLQEQQR", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "N", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "AQQLLANSTALEEAMLQEQQR", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "", "site_lbl": "N2019", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "20", "chr_pos": "62323465", "evidence": [ { "id": "rs778307053", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778307053" }, { "id": "rs778307053", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778307053" }, { "id": "rs778307053", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778307053#frequency_tab" }, { "id": "rs778307053", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778307053" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "20", "chr_pos": "62323465", "evidence": [ { "id": "rs778307053", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778307053" }, { "id": "rs778307053", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778307053" }, { "id": "rs778307053", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778307053#frequency_tab" }, { "id": "rs778307053", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778307053" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "", "site_lbl": "N2501", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "20", "chr_pos": "62317354", "evidence": [ { "id": "O15230", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O15230" }, { "id": "rs766523334", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766523334" }, { "id": "rs766523334", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766523334" }, { "id": "rs766523334", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766523334#frequency_tab" }, { "id": "rs766523334", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766523334" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "CEICAPGFYGNALLPGnCTR", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "N", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "CEICAPGFYGNALLPGNCTR", "site_lbl": "Asn2019", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "LVEAAEAHAQQLGQLALnLSSIILDVNQDR", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "LVEAAEAHAQQLGQLALNLSSIILDVNQDR", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "N", "site_lbl": "Asn2501", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "AQQLLAnSTALEEAMLQEQQR", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "N", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2568", "site_seq": "AQQLLANSTALEEAMLQEQQR", "site_lbl": "Asn2568", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2568, "end_pos": 2568, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2019", "site_seq": "", "site_lbl": "N2019", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "20", "chr_pos": "62323465", "evidence": [ { "id": "rs778307053", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778307053" }, { "id": "rs778307053", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778307053" }, { "id": "rs778307053", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778307053#frequency_tab" }, { "id": "rs778307053", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778307053" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->HCT).", "chr_id": "20", "chr_pos": "62323465", "evidence": [ { "id": "rs778307053", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778307053" }, { "id": "rs778307053", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778307053" }, { "id": "rs778307053", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778307053#frequency_tab" }, { "id": "rs778307053", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778307053" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2019, "end_pos": 2019, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "2501", "site_seq": "", "site_lbl": "N2501", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "20", "chr_pos": "62317354", "evidence": [ { "id": "O15230", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O15230" }, { "id": "rs766523334", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766523334" }, { "id": "rs766523334", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766523334" }, { "id": "rs766523334", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766523334#frequency_tab" }, { "id": "rs766523334", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766523334" } ], "disease": [ { "disease_id": "DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "url": "http://disease-ontology.org/term/DOID:2531", "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O15230-1", "start_pos": 2501, "end_pos": 2501, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-5", "gene_name": "LAMA5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 3695, "chemical_mass": 399737.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "NC_000003.12", "chr_pos": "46455829", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "3", "chr_pos": "46455828", "evidence": [ { "id": "rs745890287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745890287#frequency_tab" }, { "id": "rs745890287", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745890287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "TAGWNVPIGTLRPFLnWTGPPEPIEAAVAR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "TAGWNIPMGLLFnQTGSCK", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "Asn497", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "N", "site_lbl": "N497", "residue": "N", "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->HWT).", "chr_id": "NC_000003.12", "chr_pos": "46455829", "evidence": [] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "3", "chr_pos": "46455828", "evidence": [ { "id": "rs745890287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745890287#frequency_tab" }, { "id": "rs745890287", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745890287" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "497", "site_seq": "", "site_lbl": "N497", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "3", "chr_pos": "46445305", "evidence": [ { "id": "rs1702623675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1702623675" }, { "id": "rs1702623675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1702623675#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02788-1", "start_pos": 497, "end_pos": 497, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 710, "chemical_mass": 78182.0 } ] }, { "start_pos": "360", "site_seq": "QLVLnLTGNTLCAGGASDEK", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "QLVLnLTGNTLCAGGASDEK", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "QLVLnLTGNTLCAGGASDEK", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "7", "chr_pos": "131508973", "evidence": [ { "id": "rs960596154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs960596154" }, { "id": "rs960596154", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs960596154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "QLVLnLTGNTLCAGGASDEK", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "N", "site_lbl": "Asn360", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "360", "site_seq": "", "site_lbl": "N360", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->ILT).", "chr_id": "7", "chr_pos": "131508973", "evidence": [ { "id": "rs960596154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs960596154" }, { "id": "rs960596154", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs960596154" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O00592-1", "start_pos": 360, "end_pos": 360, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Podocalyxin", "gene_name": "PODXL", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 558, "chemical_mass": 58635.0 } ] }, { "start_pos": "1095", "site_seq": "SPYEMFGDEEVMCLNGnWTEPPQCK", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "N", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "SPYEMFGDEEVMCLNGnWTEPPQCK", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "N", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "SPYEMFGDEEVMCLNGnWTEPPQCK", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "N", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "SPYEMFGDEEVMCLNGnWTEPPQCK", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "1095", "site_seq": "N", "site_lbl": "Asn1095", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08603-1", "start_pos": 1095, "end_pos": 1095, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H", "gene_name": "CFH", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1231, "chemical_mass": 139096.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "", "site_lbl": "N43", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "11", "chr_pos": "33717411", "evidence": [ { "id": "rs1351382260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351382260" }, { "id": "rs1351382260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351382260#frequency_tab" }, { "id": "rs1351382260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351382260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "N", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVnCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "TAVNCSSDFDACLITK", "site_lbl": "Asn43", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "43", "site_seq": "", "site_lbl": "N43", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "11", "chr_pos": "33717411", "evidence": [ { "id": "rs1351382260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351382260" }, { "id": "rs1351382260", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351382260#frequency_tab" }, { "id": "rs1351382260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351382260" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P13987-1", "start_pos": 43, "end_pos": 43, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 128, "chemical_mass": 14177.0 } ] }, { "start_pos": "366", "site_seq": "LSWVQDnGTQDELTVEGTR", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06418-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "TYRO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 96905.0 } ] }, { "start_pos": "366", "site_seq": "N", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06418-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "TYRO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 96905.0 } ] }, { "start_pos": "366", "site_seq": "LSWVQDnGTQDELTVEGTR", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06418-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "TYRO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 96905.0 } ] }, { "start_pos": "366", "site_seq": "N", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06418-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "TYRO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 96905.0 } ] }, { "start_pos": "366", "site_seq": "LSWVQDnGTQDELTVEGTR", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06418-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "TYRO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 96905.0 } ] }, { "start_pos": "366", "site_seq": "N", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06418-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "TYRO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 96905.0 } ] }, { "start_pos": "366", "site_seq": "", "site_lbl": "N366", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "15", "chr_pos": "41568352", "evidence": [ { "id": "rs768932378", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768932378" }, { "id": "rs768932378", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768932378" }, { "id": "rs768932378", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768932378" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q06418-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "TYRO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 96905.0 } ] }, { "start_pos": "366", "site_seq": "LSWVQDnGTQDELTVEGTR", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06418-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "TYRO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 96905.0 } ] }, { "start_pos": "366", "site_seq": "N", "site_lbl": "Asn366", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q06418-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "TYRO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 96905.0 } ] }, { "start_pos": "366", "site_seq": "", "site_lbl": "N366", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "15", "chr_pos": "41568352", "evidence": [ { "id": "rs768932378", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768932378" }, { "id": "rs768932378", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768932378" }, { "id": "rs768932378", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768932378" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q06418-1", "start_pos": 366, "end_pos": 366, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tyrosine-protein kinase receptor TYRO3", "gene_name": "TYRO3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 890, "chemical_mass": 96905.0 } ] }, { "start_pos": "296", "site_seq": "MAWPEDHVFISTPSFnYTGR", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "296", "site_seq": "MAWPEDHVFISTPSFnYTGR", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "296", "site_seq": "MAWPEDHVFISTPSFnYTGR", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "296", "site_seq": "MAWPEDHVFISTPSFnYTGR", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04180-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 440, "chemical_mass": 49578.0 } ] }, { "start_pos": "83", "site_seq": "RAEGLYSQLLGLTASQSnLTK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "AEGLYSQLLGLTASQSnLTK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "RAEGLYSQLLGLTASQSnLTK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "AEGLYSQLLGLTASQSnLTK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "RAEGLYSQLLGLTASQSnLTK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "AEGLYSQLLGLTASQSnLTK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "19", "chr_pos": "17377041", "evidence": [ { "id": "rs1170359478", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1170359478" }, { "id": "rs1170359478", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1170359478#frequency_tab" }, { "id": "rs1170359478", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1170359478" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "RAEGLYSQLLGLTASQSnLTK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "AEGLYSQLLGLTASQSnLTK", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "N", "site_lbl": "Asn83", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "83", "site_seq": "", "site_lbl": "N83", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "19", "chr_pos": "17377041", "evidence": [ { "id": "rs1170359478", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1170359478" }, { "id": "rs1170359478", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1170359478#frequency_tab" }, { "id": "rs1170359478", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1170359478" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BX97-1", "start_pos": 83, "end_pos": 83, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Plasmalemma vesicle-associated protein", "gene_name": "PLVAP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 442, "chemical_mass": 50594.0 } ] }, { "start_pos": "127", "site_seq": "TLnQSSDELQLSMGNAMFVK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "TLnQSSDELQLSMGNAMFVK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "TLnQSSDELQLSMGNAMFVK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "14", "chr_pos": "94614821", "evidence": [ { "id": "P01011", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01011" }, { "id": "rs145819878", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145819878" }, { "id": "rs145819878", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145819878" }, { "id": "rs145819878", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145819878#frequency_tab" }, { "id": "rs145819878", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145819878" }, { "id": "rs145819878", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145819878" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "TLnQSSDELQLSMGNAMFVK", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "N", "site_lbl": "Asn127", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "127", "site_seq": "", "site_lbl": "N127", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "14", "chr_pos": "94614821", "evidence": [ { "id": "P01011", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01011" }, { "id": "rs145819878", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145819878" }, { "id": "rs145819878", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145819878" }, { "id": "rs145819878", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145819878#frequency_tab" }, { "id": "rs145819878", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145819878" }, { "id": "rs145819878", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145819878" } ], "disease": [ { "disease_id": "DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney.", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P01011-1", "start_pos": 127, "end_pos": 127, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 423, "chemical_mass": 47651.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDRNDPMLLYNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIANATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDRNDPMLLYNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIANATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDRNDPMLLYNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIANATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "3", "chr_pos": "155138234", "evidence": [ { "id": "rs1339178202", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1339178202" }, { "id": "rs1339178202", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1339178202" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "3", "chr_pos": "155138235", "evidence": [ { "id": "rs200961860", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200961860" }, { "id": "rs200961860", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200961860#frequency_tab" }, { "id": "rs200961860", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200961860" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "3", "chr_pos": "155138236", "evidence": [ { "id": "P08473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08473" }, { "id": "rs1434664230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1434664230" }, { "id": "rs1434664230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1434664230" }, { "id": "rs1434664230", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1434664230" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "3", "chr_pos": "155138235", "evidence": [ { "id": "rs200961860", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200961860" }, { "id": "rs200961860", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200961860#frequency_tab" }, { "id": "rs200961860", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200961860" } ], "disease": [ { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDRNDPMLLYNK", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIAnATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "EIANATAKPEDR", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "N", "site_lbl": "Asn285", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "285", "site_seq": "", "site_lbl": "N285", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "3", "chr_pos": "155138234", "evidence": [ { "id": "rs1339178202", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1339178202" }, { "id": "rs1339178202", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1339178202" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->IAT).", "chr_id": "3", "chr_pos": "155138235", "evidence": [ { "id": "rs200961860", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200961860" }, { "id": "rs200961860", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200961860#frequency_tab" }, { "id": "rs200961860", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200961860" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "3", "chr_pos": "155138236", "evidence": [ { "id": "P08473", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P08473" }, { "id": "rs1434664230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1434664230" }, { "id": "rs1434664230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1434664230" }, { "id": "rs1434664230", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1434664230" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "3", "chr_pos": "155138235", "evidence": [ { "id": "rs200961860", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200961860" }, { "id": "rs200961860", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200961860" }, { "id": "rs200961860", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200961860#frequency_tab" }, { "id": "rs200961860", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200961860" } ], "disease": [ { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0110160", "name": "Charcot-Marie-Tooth disease axonal type 2T", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in homozygous or compound heterozygous mutation in the MME gene on chromosome 3q25.", "url": "http://disease-ontology.org/term/DOID:0110160", "evidence": [ { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" }, { "id": "0110160", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110160" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] }, { "disease_id": "DOID:0111745", "name": "cerebellar ataxia type 43", "description": "An autosomal dominant cerebellar ataxia characterized by adult-onset, slowly progressive, gait and limb ataxia, often associated with peripheral neuropathy typically affecting the motor system that has_material_basis_in heterozygous mutation in MME on chromosome 3q25.2.", "url": "http://disease-ontology.org/term/DOID:0111745", "evidence": [ { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" }, { "id": "0111745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111745" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08473-1", "start_pos": 285, "end_pos": 285, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Neprilysin", "gene_name": "MME", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 750, "chemical_mass": 85514.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGRK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVNGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "DTCTQECSYFnITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "KDTCTQECSYFnITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "N", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "KDTCTQECSYFNITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGRK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVNGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "DTCTQECSYFnITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "KDTCTQECSYFnITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "N", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "KDTCTQECSYFNITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGRK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVNGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "DTCTQECSYFnITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "KDTCTQECSYFnITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "N", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "KDTCTQECSYFNITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "", "site_lbl": "N406", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "10", "chr_pos": "32920306", "evidence": [ { "id": "rs2094945297", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2094945297" }, { "id": "rs2094945297", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2094945297#frequency_tab" }, { "id": "rs2094945297", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2094945297" }, { "id": "rs2505884571", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2505884571" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "", "site_lbl": "N669", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "10", "chr_pos": "32910381", "evidence": [ { "id": "P05556", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05556" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "10", "chr_pos": "32910382", "evidence": [ { "id": "rs1309745209", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1309745209" }, { "id": "rs1309745209", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1309745209" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGRK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVnGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "NGVNGTGENGR", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "DTCTQECSYFnITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "KDTCTQECSYFnITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "N", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "KDTCTQECSYFNITK", "site_lbl": "Asn669", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "406", "site_seq": "", "site_lbl": "N406", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->TGT).", "chr_id": "10", "chr_pos": "32920306", "evidence": [ { "id": "rs2094945297", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2094945297" }, { "id": "rs2094945297", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2094945297#frequency_tab" }, { "id": "rs2094945297", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2094945297" }, { "id": "rs2505884571", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2505884571" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "669", "site_seq": "", "site_lbl": "N669", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "10", "chr_pos": "32910381", "evidence": [ { "id": "P05556", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P05556" } ], "disease": [ { "disease_id": "DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "10", "chr_pos": "32910382", "evidence": [ { "id": "rs1309745209", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1309745209" }, { "id": "rs1309745209", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1309745209" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05556-1", "start_pos": 669, "end_pos": 669, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 798, "chemical_mass": 88415.0 } ] }, { "start_pos": "561", "site_seq": "QLPNGELQPLSEnATLTLISTK", "site_lbl": "Asn561", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19320-1", "start_pos": 561, "end_pos": 561, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "VCAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 739, "chemical_mass": 81276.0 } ] }, { "start_pos": "561", "site_seq": "N", "site_lbl": "Asn561", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19320-1", "start_pos": 561, "end_pos": 561, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "VCAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 739, "chemical_mass": 81276.0 } ] }, { "start_pos": "561", "site_seq": "QLPNGELQPLSEnATLTLISTK", "site_lbl": "Asn561", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19320-1", "start_pos": 561, "end_pos": 561, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "VCAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 739, "chemical_mass": 81276.0 } ] }, { "start_pos": "561", "site_seq": "N", "site_lbl": "Asn561", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19320-1", "start_pos": 561, "end_pos": 561, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "VCAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 739, "chemical_mass": 81276.0 } ] }, { "start_pos": "561", "site_seq": "QLPNGELQPLSEnATLTLISTK", "site_lbl": "Asn561", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19320-1", "start_pos": 561, "end_pos": 561, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "VCAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 739, "chemical_mass": 81276.0 } ] }, { "start_pos": "561", "site_seq": "N", "site_lbl": "Asn561", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19320-1", "start_pos": 561, "end_pos": 561, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "VCAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 739, "chemical_mass": 81276.0 } ] }, { "start_pos": "561", "site_seq": "", "site_lbl": "N561", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "1", "chr_pos": "100732575", "evidence": [ { "id": "rs1660501453", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1660501453" }, { "id": "rs1660501453", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1660501453" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "1", "chr_pos": "100732574", "evidence": [ { "id": "rs1032916187", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1032916187" }, { "id": "rs1032916187", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1032916187#frequency_tab" }, { "id": "rs1032916187", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1032916187" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19320-1", "start_pos": 561, "end_pos": 561, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "VCAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 739, "chemical_mass": 81276.0 } ] }, { "start_pos": "561", "site_seq": "QLPNGELQPLSEnATLTLISTK", "site_lbl": "Asn561", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19320-1", "start_pos": 561, "end_pos": 561, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "VCAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 739, "chemical_mass": 81276.0 } ] }, { "start_pos": "561", "site_seq": "N", "site_lbl": "Asn561", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P19320-1", "start_pos": 561, "end_pos": 561, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "VCAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 739, "chemical_mass": 81276.0 } ] }, { "start_pos": "561", "site_seq": "", "site_lbl": "N561", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "1", "chr_pos": "100732575", "evidence": [ { "id": "rs1660501453", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1660501453" }, { "id": "rs1660501453", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1660501453" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "1", "chr_pos": "100732574", "evidence": [ { "id": "rs1032916187", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1032916187" }, { "id": "rs1032916187", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1032916187#frequency_tab" }, { "id": "rs1032916187", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1032916187" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P19320-1", "start_pos": 561, "end_pos": 561, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular cell adhesion protein 1", "gene_name": "VCAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 739, "chemical_mass": 81276.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "", "site_lbl": "N115", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "9", "chr_pos": "114074146", "evidence": [ { "id": "rs142267376", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142267376#frequency_tab" }, { "id": "rs142267376", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142267376" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "9", "chr_pos": "114074145", "evidence": [ { "id": "rs780025188", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780025188" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "9", "chr_pos": "114074147", "evidence": [ { "id": "rs1405775116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1405775116" }, { "id": "rs1405775116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1405775116" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "WnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "N", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "SKWnITMESYVVHTNYDEYAIFLTK", "site_lbl": "Asn115", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "YFYnGTSMACETFQYGGCMGNGNNFVTEK", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "250", "site_seq": "N", "site_lbl": "Asn250", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 250, "end_pos": 250, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "115", "site_seq": "", "site_lbl": "N115", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "9", "chr_pos": "114074146", "evidence": [ { "id": "rs142267376", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142267376" }, { "id": "rs142267376", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142267376#frequency_tab" }, { "id": "rs142267376", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142267376" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "9", "chr_pos": "114074145", "evidence": [ { "id": "rs780025188", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780025188" }, { "id": "rs780025188", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780025188" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "9", "chr_pos": "114074147", "evidence": [ { "id": "rs1405775116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1405775116" }, { "id": "rs1405775116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1405775116" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02760-1", "start_pos": 115, "end_pos": 115, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 352, "chemical_mass": 38999.0 } ] }, { "start_pos": "288", "site_seq": "nVTCENGLPAVVSCVPGQVFSPDGPSR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "NVTCENGLPAVVSCVPGQVFSPDGPSR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "N", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "nVTCENGLPAVVSCVPGQVFSPDGPSR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "NVTCENGLPAVVSCVPGQVFSPDGPSR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "N", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "nVTCENGLPAVVSCVPGQVFSPDGPSR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "NVTCENGLPAVVSCVPGQVFSPDGPSR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "N", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "", "site_lbl": "N288", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "8", "chr_pos": "23333504", "evidence": [ { "id": "rs747808882", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747808882" }, { "id": "rs747808882", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747808882" }, { "id": "rs747808882", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747808882" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "nVTCENGLPAVVSCVPGQVFSPDGPSR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "NVTCENGLPAVVSCVPGQVFSPDGPSR", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "N", "site_lbl": "Asn288", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "288", "site_seq": "", "site_lbl": "N288", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "8", "chr_pos": "23333504", "evidence": [ { "id": "rs747808882", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747808882" }, { "id": "rs747808882", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747808882" }, { "id": "rs747808882", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747808882" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9Y4K0-1", "start_pos": 288, "end_pos": 288, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Lysyl oxidase homolog 2", "gene_name": "LOXL2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 774, "chemical_mass": 86725.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "EnLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "ENLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "EnLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "ENLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "EnLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "ENLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "", "site_lbl": "N358", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->YKS).", "chr_id": "3", "chr_pos": "149206304", "evidence": [ { "id": "rs1727717120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727717120" }, { "id": "rs1727717120", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727717120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "", "site_lbl": "N397", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "3", "chr_pos": "149206185", "evidence": [ { "id": "rs146229133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146229133" }, { "id": "rs146229133", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs146229133" }, { "id": "rs146229133", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146229133" }, { "id": "rs146229133", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs146229133#frequency_tab" }, { "id": "rs146229133", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146229133" } ], "disease": [ { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "AGLQAFFQVQECnK", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "N", "site_lbl": "Asn358", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "EnLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "N", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "ENLTAPGSDSAVFFEQGTTR", "site_lbl": "Asn397", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "358", "site_seq": "", "site_lbl": "N358", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->YKS).", "chr_id": "3", "chr_pos": "149206304", "evidence": [ { "id": "rs1727717120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1727717120" }, { "id": "rs1727717120", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1727717120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 358, "end_pos": 358, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "397", "site_seq": "", "site_lbl": "N397", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "3", "chr_pos": "149206185", "evidence": [ { "id": "rs146229133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146229133" }, { "id": "rs146229133", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs146229133" }, { "id": "rs146229133", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146229133" }, { "id": "rs146229133", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs146229133#frequency_tab" }, { "id": "rs146229133", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146229133" } ], "disease": [ { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] }, { "disease_id": "DOID:0050711", "name": "aceruloplasminemia", "description": "An iron metabolism disease that has_material_basis_in a mutation in the ceruloplasmin gene characterized by progressive neurodegeneration of the retina and basal ganglia and diabetes mellitus.", "url": "http://disease-ontology.org/term/DOID:0050711", "evidence": [ { "id": "604290", "database": "MIM", "url": "https://www.omim.org/entry/604290" }, { "id": "0050711", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050711" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P00450-1", "start_pos": 397, "end_pos": 397, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1065, "chemical_mass": 122219.0 } ] }, { "start_pos": "395", "site_seq": "VIVEGQNAHGEGYVnVTVKPEPR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "VIVEGQNAHGEGYVNVTVKPEPR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "N", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "VIVEGQNAHGEGYVnVTVKPEPR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "VIVEGQNAHGEGYVNVTVKPEPR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "N", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "VIVEGQNAHGEGYVnVTVKPEPR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "VIVEGQNAHGEGYVNVTVKPEPR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "N", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "", "site_lbl": "N395", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "1", "chr_pos": "35466626", "evidence": [ { "id": "Q8IZA0", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8IZA0" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "VIVEGQNAHGEGYVnVTVKPEPR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "VIVEGQNAHGEGYVNVTVKPEPR", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "N", "site_lbl": "Asn395", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "395", "site_seq": "", "site_lbl": "N395", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "1", "chr_pos": "35466626", "evidence": [ { "id": "Q8IZA0", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q8IZA0" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q8IZA0-1", "start_pos": 395, "end_pos": 395, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Dyslexia-associated protein KIAA0319-like protein", "gene_name": "KIAA0319L", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1049, "chemical_mass": 115658.0 } ] }, { "start_pos": "81", "site_seq": "AFITnFSMIIDGMTYPGIIK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "AFITnFSMIIDGMTYPGIIK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "AFITnFSMIIDGMTYPGIIK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "", "site_lbl": "N81", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->HFS).", "chr_id": "3", "chr_pos": "52829129", "evidence": [ { "id": "rs1700528685", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1700528685" }, { "id": "rs1700528685", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1700528685#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "AFITnFSMIIDGMTYPGIIK", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "N", "site_lbl": "Asn81", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "81", "site_seq": "", "site_lbl": "N81", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->HFS).", "chr_id": "3", "chr_pos": "52829129", "evidence": [ { "id": "rs1700528685", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1700528685" }, { "id": "rs1700528685", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1700528685#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14624-1", "start_pos": 81, "end_pos": 81, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 930, "chemical_mass": 103357.0 } ] }, { "start_pos": "406", "site_seq": "DCPGnWTWPENSQQTPMCQAWGNPLPELK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "DCPGnWTWPENSQQTPMCQAWGNPLPELK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "DCPGnWTWPENSQQTPMCQAWGNPLPELK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "", "site_lbl": "N406", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "19", "chr_pos": "10284819", "evidence": [ { "id": "rs368566175", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368566175" }, { "id": "rs368566175", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368566175#frequency_tab" }, { "id": "rs368566175", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368566175" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "DCPGnWTWPENSQQTPMCQAWGNPLPELK", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "N", "site_lbl": "Asn406", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "406", "site_seq": "", "site_lbl": "N406", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "19", "chr_pos": "10284819", "evidence": [ { "id": "rs368566175", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368566175" }, { "id": "rs368566175", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368566175#frequency_tab" }, { "id": "rs368566175", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368566175" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P05362-1", "start_pos": 406, "end_pos": 406, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Intercellular adhesion molecule 1", "gene_name": "ICAM1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 532, "chemical_mass": 57825.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "11", "chr_pos": "32091354", "evidence": [ { "id": "rs764801279", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764801279" }, { "id": "rs764801279", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs764801279" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "VVRPDSELGERPPEDnQSFQYDHEAFLGK", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "N", "site_lbl": "Asn53", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "53", "site_seq": "", "site_lbl": "N53", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "11", "chr_pos": "32091354", "evidence": [ { "id": "rs764801279", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764801279" }, { "id": "rs764801279", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs764801279" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q15293-1", "start_pos": 53, "end_pos": 53, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Reticulocalbin-1", "gene_name": "RCN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 331, "chemical_mass": 38890.0 } ] }, { "start_pos": "164", "site_seq": "VTSPnITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPNITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPnITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPNITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPnITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPNITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "", "site_lbl": "N164", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "13", "chr_pos": "28438243", "evidence": [ { "id": "P17948", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17948" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "13", "chr_pos": "28438242", "evidence": [ { "id": "P17948", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17948" }, { "id": "rs1387615627", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387615627" }, { "id": "rs1387615627", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387615627#frequency_tab" }, { "id": "rs1387615627", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1387615627" }, { "id": "rs1387615627", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1387615627" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "13", "chr_pos": "28438243", "evidence": [ { "id": "rs1290255117", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1290255117" }, { "id": "rs1290255117", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1290255117" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPnITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "VTSPNITVTLK", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "N", "site_lbl": "Asn164", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "164", "site_seq": "", "site_lbl": "N164", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->IIT).", "chr_id": "13", "chr_pos": "28438243", "evidence": [ { "id": "P17948", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17948" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "13", "chr_pos": "28438242", "evidence": [ { "id": "P17948", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P17948" }, { "id": "rs1387615627", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387615627" }, { "id": "rs1387615627", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387615627#frequency_tab" }, { "id": "rs1387615627", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1387615627" }, { "id": "rs1387615627", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs1387615627" } ], "disease": [ { "disease_id": "DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung.", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "13", "chr_pos": "28438243", "evidence": [ { "id": "rs1290255117", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1290255117" }, { "id": "rs1290255117", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1290255117" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P17948-1", "start_pos": 164, "end_pos": 164, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Vascular endothelial growth factor receptor 1", "gene_name": "FLT1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1338, "chemical_mass": 150769.0 } ] }, { "start_pos": "1355", "site_seq": "LNLYLDSVnETQFCVNIPAVR", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "N", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "KVEYDHGKLNLYLDSVNETQFCVNIPAVR", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "LNLYLDSVnETQFCVNIPAVR", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "N", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "KVEYDHGKLNLYLDSVNETQFCVNIPAVR", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "LNLYLDSVnETQFCVNIPAVR", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "N", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "KVEYDHGKLNLYLDSVNETQFCVNIPAVR", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "", "site_lbl": "N1355", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->IET).", "chr_id": "6", "chr_pos": "73820465", "evidence": [ { "id": "rs748658555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748658555#frequency_tab" }, { "id": "rs748658555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748658555" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "6", "chr_pos": "73820465", "evidence": [ { "id": "rs748658555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748658555#frequency_tab" }, { "id": "rs748658555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748658555" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "LNLYLDSVnETQFCVNIPAVR", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "N", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "KVEYDHGKLNLYLDSVNETQFCVNIPAVR", "site_lbl": "Asn1355", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "1355", "site_seq": "", "site_lbl": "N1355", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->IET).", "chr_id": "6", "chr_pos": "73820465", "evidence": [ { "id": "rs748658555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748658555#frequency_tab" }, { "id": "rs748658555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748658555" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "6", "chr_pos": "73820465", "evidence": [ { "id": "rs748658555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748658555" }, { "id": "rs748658555", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748658555#frequency_tab" }, { "id": "rs748658555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748658555" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q6YHK3-1", "start_pos": 1355, "end_pos": 1355, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD109 antigen", "gene_name": "CD109", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1445, "chemical_mass": 161689.0 } ] }, { "start_pos": "163", "site_seq": "YFATnCSATFGLEDDVVK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATnCSATFGLEDDVVKK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATNCSATFGLEDDVVKK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "N", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATnCSATFGLEDDVVK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATnCSATFGLEDDVVKK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATNCSATFGLEDDVVKK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "N", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATnCSATFGLEDDVVK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATnCSATFGLEDDVVKK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATNCSATFGLEDDVVKK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "N", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "", "site_lbl": "N163", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->HCS).", "chr_id": "12", "chr_pos": "95787037", "evidence": [ { "id": "rs2079172773", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2079172773" }, { "id": "rs2079172773", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2079172773#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATnCSATFGLEDDVVK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATnCSATFGLEDDVVKK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "YFATNCSATFGLEDDVVKK", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "N", "site_lbl": "Asn163", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "163", "site_seq": "", "site_lbl": "N163", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->HCS).", "chr_id": "12", "chr_pos": "95787037", "evidence": [ { "id": "rs2079172773", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2079172773" }, { "id": "rs2079172773", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2079172773#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9HB63-1", "start_pos": 163, "end_pos": 163, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Netrin-4", "gene_name": "NTN4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 628, "chemical_mass": 70071.0 } ] }, { "start_pos": "3465", "site_seq": "YDFnSSMLYSTAK", "site_lbl": "Asn3465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3465, "end_pos": 3465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3465", "site_seq": "N", "site_lbl": "Asn3465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3465, "end_pos": 3465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3465", "site_seq": "YDFnSSMLYSTAK", "site_lbl": "Asn3465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3465, "end_pos": 3465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3465", "site_seq": "N", "site_lbl": "Asn3465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3465, "end_pos": 3465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3465", "site_seq": "YDFnSSMLYSTAK", "site_lbl": "Asn3465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3465, "end_pos": 3465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3465", "site_seq": "N", "site_lbl": "Asn3465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3465, "end_pos": 3465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3465", "site_seq": "", "site_lbl": "N3465", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "2", "chr_pos": "21006475", "evidence": [ { "id": "rs751227728", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751227728" }, { "id": "rs751227728", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751227728" }, { "id": "rs751227728", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751227728" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "2", "chr_pos": "21006474", "evidence": [ { "id": "rs1663141372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1663141372" }, { "id": "rs1663141372", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1663141372" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3465, "end_pos": 3465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3465", "site_seq": "YDFnSSMLYSTAK", "site_lbl": "Asn3465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3465, "end_pos": 3465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3465", "site_seq": "N", "site_lbl": "Asn3465", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3465, "end_pos": 3465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "3465", "site_seq": "", "site_lbl": "N3465", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "2", "chr_pos": "21006475", "evidence": [ { "id": "rs751227728", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751227728" }, { "id": "rs751227728", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751227728" }, { "id": "rs751227728", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751227728" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "2", "chr_pos": "21006474", "evidence": [ { "id": "rs1663141372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1663141372" }, { "id": "rs1663141372", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1663141372" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04114-1", "start_pos": 3465, "end_pos": 3465, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 4563, "chemical_mass": 515545.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "", "site_lbl": "N1223", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "1", "chr_pos": "183132500", "evidence": [ { "id": "rs892534215", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs892534215" }, { "id": "rs892534215", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs892534215#frequency_tab" }, { "id": "rs892534215", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs892534215" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "1", "chr_pos": "183132502", "evidence": [ { "id": "rs1571463550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1571463550" }, { "id": "rs1571463550", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1571463550#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "", "site_lbl": "N1241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "P11047", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P11047" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNRK", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGEnQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "TLAGENQTAFEIEELNR", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "N", "site_lbl": "Asn1223", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "nISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "N", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "NISQDLEK", "site_lbl": "Asn1241", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1223", "site_seq": "", "site_lbl": "N1223", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "1", "chr_pos": "183132500", "evidence": [ { "id": "rs892534215", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs892534215" }, { "id": "rs892534215", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs892534215#frequency_tab" }, { "id": "rs892534215", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs892534215" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT).", "chr_id": "1", "chr_pos": "183132502", "evidence": [ { "id": "rs1571463550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1571463550" }, { "id": "rs1571463550", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1571463550#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1223, "end_pos": 1223, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "1241", "site_seq": "", "site_lbl": "N1241", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "rs758238704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758238704" }, { "id": "rs758238704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758238704" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIS->TIS).", "chr_id": "1", "chr_pos": "183133423", "evidence": [ { "id": "P11047", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P11047" } ], "disease": [ { "disease_id": "DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "url": "http://disease-ontology.org/term/DOID:1319", "evidence": [ { "id": "1319", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1319" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P11047-1", "start_pos": 1241, "end_pos": 1241, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1609, "chemical_mass": 177603.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "8", "chr_pos": "18059633", "evidence": [ { "id": "rs1799610079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799610079" }, { "id": "rs1799610079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799610079" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "8", "chr_pos": "18059632", "evidence": [ { "id": "rs371154344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371154344#frequency_tab" }, { "id": "rs371154344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371154344" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGnQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "N", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "ILAPAYFILGGNQSGEGCVITR", "site_lbl": "Asn286", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "N286", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "8", "chr_pos": "18059633", "evidence": [ { "id": "rs1799610079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1799610079" }, { "id": "rs1799610079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1799610079" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "8", "chr_pos": "18059632", "evidence": [ { "id": "rs371154344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371154344" }, { "id": "rs371154344", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371154344#frequency_tab" }, { "id": "rs371154344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371154344" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "286", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "No effect on ceramide catabolic process.", "evidence": [ { "database": "UniProtKB", "id": "Q13510", "url": "https://www.uniprot.org/uniprotkb/Q13510" }, { "database": "PubMed", "id": "11451951", "url": "https://glygen.org/publication/PubMed/11451951" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13510-1", "start_pos": 286, "end_pos": 286, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 395, "chemical_mass": 44660.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "CIQAnYSLMENGK", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "65", "site_seq": "N", "site_lbl": "Asn65", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P05090-1", "start_pos": 65, "end_pos": 65, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 189, "chemical_mass": 21276.0 } ] }, { "start_pos": "116", "site_seq": "VCSNDnK", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09486-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 34632.0 } ] }, { "start_pos": "116", "site_seq": "N", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09486-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 34632.0 } ] }, { "start_pos": "116", "site_seq": "VCSNDnK", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09486-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 34632.0 } ] }, { "start_pos": "116", "site_seq": "N", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09486-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 34632.0 } ] }, { "start_pos": "116", "site_seq": "VCSNDnK", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09486-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 34632.0 } ] }, { "start_pos": "116", "site_seq": "N", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09486-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 34632.0 } ] }, { "start_pos": "116", "site_seq": "VCSNDnK", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09486-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 34632.0 } ] }, { "start_pos": "116", "site_seq": "N", "site_lbl": "Asn116", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P09486-1", "start_pos": 116, "end_pos": 116, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 303, "chemical_mass": 34632.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "1", "chr_pos": "203486711", "evidence": [ { "id": "rs958031131", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs958031131" }, { "id": "rs958031131", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs958031131#frequency_tab" }, { "id": "rs958031131", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs958031131" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "203486712", "evidence": [ { "id": "rs760584616", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760584616" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "IHYLYLQNNFITELPVESFQnATGLR", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "124", "site_seq": "N", "site_lbl": "Asn124", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 124, "end_pos": 124, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "InGTQICPNDLVAFHDFSSDLENVPHLR", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "N", "site_lbl": "Asn327", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "327", "site_seq": "", "site_lbl": "N327", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->DGT).", "chr_id": "1", "chr_pos": "203486711", "evidence": [ { "id": "rs958031131", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs958031131" }, { "id": "rs958031131", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs958031131#frequency_tab" }, { "id": "rs958031131", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs958031131" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "1", "chr_pos": "203486712", "evidence": [ { "id": "rs760584616", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760584616" }, { "id": "rs760584616", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760584616" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P51888-1", "start_pos": 327, "end_pos": 327, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Prolargin", "gene_name": "PRELP", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 382, "chemical_mass": 43810.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "", "site_lbl": "N200", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTAnVTLGPQLMEVTVYRR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "N", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "VSVNTANVTLGPQLMEVTVYR", "site_lbl": "Asn200", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "DLPIMFDVLIHDPSHFLnYSTINYK", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "275", "site_seq": "N", "site_lbl": "Asn275", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 275, "end_pos": 275, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "200", "site_seq": "", "site_lbl": "N200", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->HVT).", "chr_id": "7", "chr_pos": "23260036", "evidence": [ { "id": "rs776089652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776089652" }, { "id": "rs776089652", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776089652#frequency_tab" }, { "id": "rs776089652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776089652" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "7", "chr_pos": "23260037", "evidence": [ { "id": "rs911583615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs911583615" }, { "id": "rs911583615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs911583615#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q14956-1", "start_pos": 200, "end_pos": 200, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 572, "chemical_mass": 63923.0 } ] }, { "start_pos": "156", "site_seq": "VCQDCPLLAPLnDTR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "VCQDCPLLAPLnDTR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "VCQDCPLLAPLnDTR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "3", "chr_pos": "186617245", "evidence": [ { "id": "rs373886640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373886640" }, { "id": "rs373886640", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373886640#frequency_tab" }, { "id": "rs373886640", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373886640" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->TDT).", "chr_id": "3", "chr_pos": "186617244", "evidence": [ { "id": "rs1420998178", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420998178" }, { "id": "rs1420998178", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420998178" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "186617300", "evidence": [ { "id": "rs1244707129", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244707129" }, { "id": "rs1244707129", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244707129" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "3", "chr_pos": "186617302", "evidence": [ { "id": "rs770113523", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770113523" }, { "id": "rs770113523", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770113523" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "186617301", "evidence": [ { "id": "rs556158119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556158119" }, { "id": "rs556158119", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs556158119#frequency_tab" }, { "id": "rs556158119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556158119" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "3", "chr_pos": "186617303", "evidence": [ { "id": "rs1167553984", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167553984" }, { "id": "rs1167553984", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1167553984" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "VCQDCPLLAPLnDTR", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "N", "site_lbl": "Asn156", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "AALAAFNAQNnGSNFQLEEISR", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "N", "site_lbl": "Asn176", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "156", "site_seq": "", "site_lbl": "N156", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->KDT).", "chr_id": "3", "chr_pos": "186617245", "evidence": [ { "id": "rs373886640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs373886640" }, { "id": "rs373886640", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373886640" }, { "id": "rs373886640", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373886640#frequency_tab" }, { "id": "rs373886640", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373886640" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->TDT).", "chr_id": "3", "chr_pos": "186617244", "evidence": [ { "id": "rs1420998178", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420998178" }, { "id": "rs1420998178", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420998178" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 156, "end_pos": 156, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "176", "site_seq": "", "site_lbl": "N176", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "3", "chr_pos": "186617300", "evidence": [ { "id": "rs1244707129", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244707129" }, { "id": "rs1244707129", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244707129" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "3", "chr_pos": "186617302", "evidence": [ { "id": "rs770113523", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770113523" }, { "id": "rs770113523", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770113523" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "186617301", "evidence": [ { "id": "rs556158119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556158119" }, { "id": "rs556158119", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556158119" }, { "id": "rs556158119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs556158119#frequency_tab" }, { "id": "rs556158119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs556158119" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->YGS).", "chr_id": "3", "chr_pos": "186617303", "evidence": [ { "id": "rs1167553984", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167553984" }, { "id": "rs1167553984", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1167553984" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02765-1", "start_pos": 176, "end_pos": 176, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 367, "chemical_mass": 39341.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEEnVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEENVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "N", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEEnVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEENVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "N", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEEnVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEENVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "N", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "", "site_lbl": "N480", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "3", "chr_pos": "105550191", "evidence": [ { "id": "Q13740", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q13740" }, { "id": "rs1940358284", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1940358284" }, { "id": "rs1940358284", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1940358284#frequency_tab" }, { "id": "rs1940358284", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1940358284" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEEnVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "IIISPEENVTLTCTAENQLER", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "N", "site_lbl": "Asn480", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "480", "site_seq": "", "site_lbl": "N480", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "3", "chr_pos": "105550191", "evidence": [ { "id": "Q13740", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q13740" }, { "id": "rs1940358284", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1940358284" }, { "id": "rs1940358284", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1940358284#frequency_tab" }, { "id": "rs1940358284", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1940358284" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q13740-1", "start_pos": 480, "end_pos": 480, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "CD166 antigen", "gene_name": "ALCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 583, "chemical_mass": 65102.0 } ] }, { "start_pos": "75", "site_seq": "GVAVTnTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "N", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "GVAVTNTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "GVAVTnTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "N", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "GVAVTNTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "GVAVTnTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "N", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "GVAVTNTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "", "site_lbl": "N75", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "12", "chr_pos": "121217222", "evidence": [ { "id": "rs761894408", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761894408" }, { "id": "rs761894408", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761894408" }, { "id": "rs761894408", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761894408" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "12", "chr_pos": "121217223", "evidence": [ { "id": "rs1365692488", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1365692488" }, { "id": "rs1365692488", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1365692488" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "GVAVTnTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "N", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "GVAVTNTSK", "site_lbl": "Asn75", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "75", "site_seq": "", "site_lbl": "N75", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->DTS).", "chr_id": "12", "chr_pos": "121217222", "evidence": [ { "id": "rs761894408", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761894408" }, { "id": "rs761894408", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761894408" }, { "id": "rs761894408", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761894408" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "12", "chr_pos": "121217223", "evidence": [ { "id": "rs1365692488", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1365692488" }, { "id": "rs1365692488", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1365692488" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q99571-1", "start_pos": 75, "end_pos": 75, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "P2X purinoceptor 4", "gene_name": "P2RX4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 388, "chemical_mass": 43369.0 } ] }, { "start_pos": "153", "site_seq": "QIATGVSDTICEPCPVGFFSnVSSAFEK", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "QIATGVSDTICEPCPVGFFSnVSSAFEK", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "QIATGVSDTICEPCPVGFFSnVSSAFEK", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "", "site_lbl": "N153", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->DVS).", "chr_id": "20", "chr_pos": "46123179", "evidence": [ { "id": "rs2085353847", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2085353847" }, { "id": "rs2085353847", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2085353847#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->IVS).", "chr_id": "20", "chr_pos": "46123180", "evidence": [ { "id": "rs745551504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745551504" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "20", "chr_pos": "46123180", "evidence": [ { "id": "rs745551504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745551504" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "QIATGVSDTICEPCPVGFFSnVSSAFEK", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "N", "site_lbl": "Asn153", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "153", "site_seq": "", "site_lbl": "N153", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->DVS).", "chr_id": "20", "chr_pos": "46123179", "evidence": [ { "id": "rs2085353847", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2085353847" }, { "id": "rs2085353847", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2085353847#frequency_tab" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->IVS).", "chr_id": "20", "chr_pos": "46123180", "evidence": [ { "id": "rs745551504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745551504" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "20", "chr_pos": "46123180", "evidence": [ { "id": "rs745551504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745551504" }, { "id": "rs745551504", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745551504" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P25942-1", "start_pos": 153, "end_pos": 153, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tumor necrosis factor receptor superfamily member 5", "gene_name": "CD40", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 277, "chemical_mass": 30619.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "SCQDINECEHRnHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "nHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "N", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "296", "site_seq": "NHTCNLQQTCYNLQGGFK", "site_lbl": "Asn296", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9UBX5-1", "start_pos": 296, "end_pos": 296, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Fibulin-5", "gene_name": "FBLN5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 448, "chemical_mass": 50180.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVnVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVNVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVnVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVNVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVnVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVNVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVnVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "N", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "98", "site_seq": "LGHCPDPVLVNGEFSSSGPVNVSDK", "site_lbl": "Asn98", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P20851-1", "start_pos": 98, "end_pos": 98, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 252, "chemical_mass": 28357.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFR", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "N", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "QQQHLFGSnVTDCSGNFCLFRSETK", "site_lbl": "Asn630", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "630", "site_seq": "", "site_lbl": "N630", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).", "chr_id": "3", "chr_pos": "133777066", "evidence": [ { "id": "rs754752269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754752269" }, { "id": "rs754752269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754752269#frequency_tab" }, { "id": "rs754752269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754752269" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P02787-1", "start_pos": 630, "end_pos": 630, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Serotransferrin", "gene_name": "TF", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 698, "chemical_mass": 77064.0 } ] }, { "start_pos": "400", "site_seq": "REQFCPPPPQIPNAQnMTTTVNYQDGEK", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "N", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "EQFCPPPPQIPNAQnMTTTVNYQDGEK", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "REQFCPPPPQIPNAQnMTTTVNYQDGEK", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "N", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "EQFCPPPPQIPNAQnMTTTVNYQDGEK", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "REQFCPPPPQIPNAQnMTTTVNYQDGEK", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "N", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "EQFCPPPPQIPNAQnMTTTVNYQDGEK", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "REQFCPPPPQIPNAQnMTTTVNYQDGEK", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "N", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "400", "site_seq": "EQFCPPPPQIPNAQnMTTTVNYQDGEK", "site_lbl": "Asn400", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BXR6-1", "start_pos": 400, "end_pos": 400, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 569, "chemical_mass": 64419.0 } ] }, { "start_pos": "249", "site_seq": "KDGTVTAGnASGVADGAGAVIIASEDAVK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42765-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "3-ketoacyl-CoA thiolase, mitochondrial", "gene_name": "ACAA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 41924.0 } ] }, { "start_pos": "249", "site_seq": "DGTVTAGnASGVADGAGAVIIASEDAVK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42765-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "3-ketoacyl-CoA thiolase, mitochondrial", "gene_name": "ACAA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 41924.0 } ] }, { "start_pos": "249", "site_seq": "KDGTVTAGnASGVADGAGAVIIASEDAVK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42765-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "3-ketoacyl-CoA thiolase, mitochondrial", "gene_name": "ACAA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 41924.0 } ] }, { "start_pos": "249", "site_seq": "DGTVTAGnASGVADGAGAVIIASEDAVK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42765-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "3-ketoacyl-CoA thiolase, mitochondrial", "gene_name": "ACAA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 41924.0 } ] }, { "start_pos": "249", "site_seq": "KDGTVTAGnASGVADGAGAVIIASEDAVK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42765-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "3-ketoacyl-CoA thiolase, mitochondrial", "gene_name": "ACAA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 41924.0 } ] }, { "start_pos": "249", "site_seq": "DGTVTAGnASGVADGAGAVIIASEDAVK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42765-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "3-ketoacyl-CoA thiolase, mitochondrial", "gene_name": "ACAA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 41924.0 } ] }, { "start_pos": "249", "site_seq": "KDGTVTAGnASGVADGAGAVIIASEDAVK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42765-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "3-ketoacyl-CoA thiolase, mitochondrial", "gene_name": "ACAA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 41924.0 } ] }, { "start_pos": "249", "site_seq": "DGTVTAGnASGVADGAGAVIIASEDAVK", "site_lbl": "Asn249", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P42765-1", "start_pos": 249, "end_pos": 249, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "3-ketoacyl-CoA thiolase, mitochondrial", "gene_name": "ACAA2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 397, "chemical_mass": 41924.0 } ] }, { "start_pos": "198", "site_seq": "FITSILYENNVITIDLVQnSSQK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "FITSILYENNVITIDLVQnSSQK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "FITSILYENNVITIDLVQnSSQK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "N198", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "2", "chr_pos": "47378989", "evidence": [ { "id": "P16422", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16422" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->YSS).", "chr_id": "2", "chr_pos": "47378989", "evidence": [ { "id": "rs1671503097", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1671503097" }, { "id": "rs1671503097", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1671503097" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "FITSILYENNVITIDLVQnSSQK", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "N", "site_lbl": "Asn198", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "N198", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "2", "chr_pos": "47378989", "evidence": [ { "id": "P16422", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P16422" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->YSS).", "chr_id": "2", "chr_pos": "47378989", "evidence": [ { "id": "rs1671503097", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1671503097" }, { "id": "rs1671503097", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1671503097" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "198", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Decreased glycosylation, reduced protein stability and significant decrease in protein expression. Complete loss of glycosylation and substantial decrease in protein expression; when associated with A-74 and A-111.", "evidence": [ { "database": "UniProtKB", "id": "P16422", "url": "https://www.uniprot.org/uniprotkb/P16422" }, { "database": "PubMed", "id": "18508581", "url": "https://glygen.org/publication/PubMed/18508581" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P16422-1", "start_pos": 198, "end_pos": 198, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 314, "chemical_mass": 34932.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "LLQVVYLHSNnITK", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "N", "site_lbl": "Asn311", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "311", "site_seq": "", "site_lbl": "N311", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->DIT).", "chr_id": "X", "chr_pos": "153508269", "evidence": [ { "id": "rs2521228130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2521228130" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->nullIT).", "chr_id": "X", "chr_pos": "153508267ACA", "evidence": [ { "id": "rs2124243120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2124243120" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P21810-1", "start_pos": 311, "end_pos": 311, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Biglycan", "gene_name": "BGN", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 368, "chemical_mass": 41654.0 } ] }, { "start_pos": "125", "site_seq": "VIDFnCTTSSVSSALANTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "VIDFnCTTSSVSSALANTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "VIDFnCTTSSVSSALANTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "3", "chr_pos": "186670012", "evidence": [ { "id": "rs1718738010", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1718738010" }, { "id": "rs1718738010", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1718738010#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "VIDFnCTTSSVSSALANTK", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "N", "site_lbl": "Asn125", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "125", "site_seq": "", "site_lbl": "N125", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->KCT).", "chr_id": "3", "chr_pos": "186670012", "evidence": [ { "id": "rs1718738010", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1718738010" }, { "id": "rs1718738010", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1718738010#frequency_tab" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P04196-1", "start_pos": 125, "end_pos": 125, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 525, "chemical_mass": 59578.0 } ] }, { "start_pos": "165", "site_seq": "LnLTTDPK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "LNLTTDPK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "LnLTTDPK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "LNLTTDPK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "LnLTTDPK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "LNLTTDPK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "", "site_lbl": "N165", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "16", "chr_pos": "74508902", "evidence": [ { "id": "rs1567491667", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567491667" }, { "id": "rs1567491667", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567491667" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "16", "chr_pos": "74508903", "evidence": [ { "id": "Q92896", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92896" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "LnLTTDPK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "N", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "LNLTTDPK", "site_lbl": "Asn165", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "165", "site_seq": "", "site_lbl": "N165", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "16", "chr_pos": "74508902", "evidence": [ { "id": "rs1567491667", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567491667" }, { "id": "rs1567491667", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567491667" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "16", "chr_pos": "74508903", "evidence": [ { "id": "Q92896", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q92896" } ], "disease": [ { "disease_id": "DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus.", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q92896-1", "start_pos": 165, "end_pos": 165, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1179, "chemical_mass": 134552.0 } ] }, { "start_pos": "1093", "site_seq": "TPADNGLILLMVnGSMFFR", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1093", "site_seq": "N", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1093", "site_seq": "TPADNGLILLMVnGSMFFR", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1093", "site_seq": "N", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1093", "site_seq": "TPADNGLILLMVnGSMFFR", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1093", "site_seq": "N", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1093", "site_seq": "", "site_lbl": "N1093", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "6", "chr_pos": "112139125", "evidence": [ { "id": "rs782550866", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782550866" }, { "id": "rs782550866", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782550866" }, { "id": "rs782550866", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782550866#frequency_tab" }, { "id": "rs782550866", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782550866" } ], "disease": [ { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1093", "site_seq": "TPADNGLILLMVnGSMFFR", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1093", "site_seq": "N", "site_lbl": "Asn1093", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "1093", "site_seq": "", "site_lbl": "N1093", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "6", "chr_pos": "112139125", "evidence": [ { "id": "rs782550866", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782550866" }, { "id": "rs782550866", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782550866" }, { "id": "rs782550866", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782550866#frequency_tab" }, { "id": "rs782550866", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782550866" } ], "disease": [ { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] }, { "disease_id": "DOID:0110438", "name": "dilated cardiomyopathy 1JJ", "description": "A dilated cardiomyopathy that has_material_basis_in mutation in the LAMA4 gene on chromosome 6q21.", "url": "http://disease-ontology.org/term/DOID:0110438", "evidence": [ { "id": "615235", "database": "MIM", "url": "https://www.omim.org/entry/615235" }, { "id": "0110438", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110438" } ] } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q16363-1", "start_pos": 1093, "end_pos": 1093, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Laminin subunit alpha-4", "gene_name": "LAMA4", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 1823, "chemical_mass": 202568.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTnYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "N", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTNYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTnYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "N", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTNYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTnYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "N", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTNYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTnYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "N", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "CCGFTNYTDFEDSPYFK", "site_lbl": "Asn154", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "154", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O60635", "url": "https://www.uniprot.org/uniprotkb/O60635" }, { "database": "PubMed", "id": "19508227", "url": "https://glygen.org/publication/PubMed/19508227" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "O60635-1", "start_pos": 154, "end_pos": 154, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Tetraspanin-1", "gene_name": "TSPAN1", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 241, "chemical_mass": 26301.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTnSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTNSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTnSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTNSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTnSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTNSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "", "site_lbl": "N381", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "11", "chr_pos": "62885196", "evidence": [ { "id": "rs751788730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751788730" }, { "id": "rs751788730", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751788730" }, { "id": "rs751788730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751788730" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTnSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "N", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "LLIAGTNSSDLQQILSLLESNK", "site_lbl": "Asn381", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "", "site_lbl": "N381", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 0 out of 0 filters:", "chr_id": "11", "chr_pos": "62885196", "evidence": [ { "id": "rs751788730", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751788730" }, { "id": "rs751788730", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751788730" }, { "id": "rs751788730", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751788730" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "381", "site_seq": "", "site_lbl": "", "residue": "", "mutagenesis": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "Q", "comment": "Impairs both the stability and the trafficking of SLC3A2 to the plasma membrane; when associated with Q-365; Q-424 and Q-506.", "evidence": [ { "database": "UniProtKB", "id": "P08195", "url": "https://www.uniprot.org/uniprotkb/P08195" }, { "database": "PubMed", "id": "36028562", "url": "https://glygen.org/publication/PubMed/36028562" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "P08195-1", "start_pos": 381, "end_pos": 381, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 630, "chemical_mass": 67994.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "", "site_lbl": "N546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "X", "chr_pos": "15572229", "evidence": [ { "id": "rs761944150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761944150#frequency_tab" }, { "id": "rs761944150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761944150" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "X", "chr_pos": "15572228", "evidence": [ { "id": "rs756905974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs756905974" }, { "id": "rs756905974", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756905974" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISnSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "N", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "CDISNSTEAGQK", "site_lbl": "Asn546", "residue": "Asn", "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] }, { "start_pos": "546", "site_seq": "", "site_lbl": "N546", "residue": "", "snv": [ { "weight": 100, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "X", "chr_pos": "15572229", "evidence": [ { "id": "rs761944150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761944150" }, { "id": "rs761944150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761944150#frequency_tab" }, { "id": "rs761944150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761944150" } ] }, { "weight": 100, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "X", "chr_pos": "15572228", "evidence": [ { "id": "rs756905974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs756905974" }, { "id": "rs756905974", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756905974" }, { "id": "rs756905974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756905974" } ] } ], "glycoprotein": [ { "uniprot_canonical_ac": "Q9BYF1-1", "start_pos": 546, "end_pos": 546, "residue": "Asn", "evidence": [ { "database": "PubMed", "id": "37074911", "url": "https://glygen.org/publication/PubMed/37074911" }, { "database": "PDC", "id": "PDC000471", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_id": 9606, "tax_name": "Homo sapiens", "tax_common_name": "Human", "length": 805, "chemical_mass": 92463.0 } ] } ], "record_id": "G00273SJ" }