{ "uniprot_canonical_ac": "A0A1D5PRB6-1", "uniprot_ac": "A0A1D5PRB6", "uniprot_id": "A0A1D5PRB6_CHICK", "mass": { "chemical_mass": 10906.0, "monoisotopic_mass": 10906.0 }, "refseq": { "ac": "NP_001264825", "name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264825" }, "gene_names": [ { "name": "NDUFB2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6", "id": "A0A1D5PRB6" }, { "name": "NDUFB2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264825", "id": "NP_001264825" } ], "protein_names": [ { "name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6/entry#names_and_taxonomy", "id": "A0A1D5PRB6" }, { "name": "Complex I-AGGG", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6/entry#names_and_taxonomy", "id": "A0A1D5PRB6" }, { "name": "NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264825", "id": "NP_001264825" }, { "name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264825", "id": "NP_001264825" }, { "name": "NADH-ubiquinone oxidoreductase AGGG subunit", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6/entry#names_and_taxonomy", "id": "A0A1D5PRB6" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: BU468726.1, CR353359.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CN227462.1, BU441306.1, BU289042.1, BU230278.1 and CN227063.1. On Apr 27, 2013 this sequence version replaced XP_416351.1. Sequence Note: This RefSeq record was created from transcript data from different strains because no single transcript from the same strain was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data.", "evidence": [ { "database": "RefSeq", "id": "NP_001264825", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264825" } ] }, { "annotation": "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRB6", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6#function" }, { "database": "UniProtKB", "id": "ARBA00003195", "url": "https://www.uniprot.org/uniprotkb/ARBA00003195#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRB6", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "NDUFB2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6", "locus": { "chromosome": "1", "start_pos": 56964252, "end_pos": 56963418, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010013416", "url": "https://www.ensembl.org/id/ENSGALG00010013416" } ] } } ], "crossref": [ { "id": "A0A1D5PRB6", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PRB6", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000032595", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000032595", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "418118", "url": "https://www.ncbi.nlm.nih.gov/gene/418118", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR026627", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026627", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:418118", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:418118", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HLWHDPD", "url": "https://omabrowser.org/oma/group/HLWHDPD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PRB6", "url": "https://www.orthodb.org/?gene=A0A1D5PRB6", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15223", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15223", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15223:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15223:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF14813", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF14813", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-611105", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-6799198", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001264825", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264825", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PRB6", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PRB6-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLASLGRSAGRLLRVGGVAAGRRHAGGEVHIEPRYRQFPELTRSQVVWSEVLSGFMWFWILWHFWHSSDSVLGHFPYPDSSAWTDEELGIPPDDAE", "length": 96, "header": "tr|A0A1D5PRB6-1|A0A1D5PRB6_CHICK Isoform 1 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial OS=Gallus gallus OX=9031 GN=NDUFB2 PE=3 SV=1 CANONICAL=A0A1D5PRB6-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PRB6-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6/entry#A0A1D5PRB6-1", "sequence": { "sequence": "MLASLGRSAGRLLRVGGVAAGRRHAGGEVHIEPRYRQFPELTRSQVVWSEVLSGFMWFWILWHFWHSSDSVLGHFPYPDSSAWTDEELGIPPDDAE", "length": 96, "header": "tr|A0A1D5PRB6-1|A0A1D5PRB6_CHICK Isoform 1 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial OS=Gallus gallus OX=9031 GN=NDUFB2 PE=3 SV=1 CANONICAL=A0A1D5PRB6-1" }, "locus": { "chromosome": "1", "start_pos": 56963959, "end_pos": 56963519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010032295.1", "url": "https://www.ensembl.org/id/ENSGALT00010032295.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010019087.1", "url": "https://www.ensembl.org/id/ENSGALP00010019087.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:418118", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:418118", "resource": "KEGG Pathway" }, { "id": "R-GGA-611105", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-611105", "resource": "Reactome", "description": "Respiratory electron transport" }, { "id": "R-GGA-6799198", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-6799198", "resource": "Reactome", "description": "Complex I biogenesis" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A4X1V766-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial", "gene_name": "NDUFB2", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MSPLQRLAPFTRVGGRFLRGRGAGVAGGGGVRHAGGGVHIEPRYRQFPQLTRSQLIQAEFFSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGILPDDED", "length": 105 }, "evidence": [ { "id": "A0A1D5PRB6", "url": "https://omabrowser.org/oma/group/A0A1D5PRB6/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A8I5ZYQ3-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial", "gene_name": "ENSRNOG00000068255", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "SCSHELAPFILESGKFRHAGGGVHIQPRYKEFPQLTRCQGDPGRVLNLALAFWILWRFWHDSDAVPGPFSYPDPSQWTDEESGIPPDDD", "length": 89 }, "evidence": [ { "id": "A0A1D5PRB6", "url": "https://omabrowser.org/oma/group/A0A1D5PRB6/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "O95178-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial", "gene_name": "NDUFB2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED", "length": 105 }, "evidence": [ { "id": "A0A1D5PRB6", "url": "https://omabrowser.org/oma/group/A0A1D5PRB6/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q02374-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial", "gene_name": "NDUFB2", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MAGMSALKRLAPFAHVGGHLFRGRCARAAGARGVRRAGGGAHIEPRYRQFPQLTRSQVIQAEFFSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGIPPDDED", "length": 108 }, "evidence": [ { "id": "A0A1D5PRB6", "url": "https://omabrowser.org/oma/group/A0A1D5PRB6/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q9CPU2-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial", "gene_name": "Ndufb2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSALTRLVPFGRVGGRLLRGCRARAAGDSGVRHAGGGVHIQPRYREFPQLTRSQVIQGEFLSSLMWFWILWRFWHDSDAVLGHFSYPDPSQWTDEELGIPPDDED", "length": 105 }, "evidence": [ { "id": "A0A1D5PRB6", "url": "https://omabrowser.org/oma/group/A0A1D5PRB6/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRB6", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6" } ], "pmid": "" }, { "name": "respiratory chain complex I", "id": "GO:0045271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045271", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRB6", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "mitochondrial respiratory chain complex I assembly", "id": "GO:0032981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032981", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRB6", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRB6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PRB6-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 96, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PRB6-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A1D5PRB6" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }