{ "uniprot_canonical_ac": "A0A1D5PL43-1", "uniprot_ac": "A0A1D5PL43", "uniprot_id": "A0A1D5PL43_CHICK", "mass": { "chemical_mass": 26784.0, "monoisotopic_mass": 26784.0 }, "refseq": { "ac": "XP_015135226", "name": "GS homeobox 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015135226" }, "gene_names": [ { "name": "GSX1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43", "id": "A0A1D5PL43" }, { "name": "GSX1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015135226", "id": "XP_015135226" } ], "protein_names": [ { "name": "GS homeobox 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015135226", "id": "XP_015135226" }, { "name": "GS homeobox 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43/entry#names_and_taxonomy", "id": "A0A1D5PL43" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052532.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_015135226", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015135226" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "GSX1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43", "locus": { "chromosome": "1", "start_pos": 175947280, "end_pos": 175948883, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010004613", "url": "https://www.ensembl.org/id/ENSGALG00010004613" } ] } } ], "crossref": [ { "id": "A0A1D5PL43", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PL43", "database": "AlphaFoldDB", "categories": [] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "107052208", "url": "https://www.ncbi.nlm.nih.gov/gene/107052208", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020479", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020479", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042191", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042191", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:107052208", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:107052208", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FGSQYCP", "url": "https://omabrowser.org/oma/group/FGSQYCP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PL43", "url": "https://www.orthodb.org/?gene=A0A1D5PL43", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47421", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47421", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47421:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47421:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00046", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_015135226", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015135226", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PL43-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPRSFLVDSLVLREAGEKKGEGSPPPPLFPYAVHPSHPLPGLPAGACHARKAGLLCVCPLCVTASQLHPPPPAIPLLKASFPPFGSQYCHPPLGRQQHSVSAVSVGHGPALYQGAYPLPDPRQFHCISVDSTSSQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSGSHRGGGPGHSCKCSALSTTKCSEDDEDLRMSPSSSGKDDRGLAATP", "length": 247, "header": "tr|A0A1D5PL43-1|A0A1D5PL43_CHICK Isoform 1 of GS homeobox 1 OS=Gallus gallus OX=9031 GN=GSX1 PE=3 SV=1 CANONICAL=A0A1D5PL43-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PL43-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43/entry#A0A1D5PL43-1", "sequence": { "sequence": "MPRSFLVDSLVLREAGEKKGEGSPPPPLFPYAVHPSHPLPGLPAGACHARKAGLLCVCPLCVTASQLHPPPPAIPLLKASFPPFGSQYCHPPLGRQQHSVSAVSVGHGPALYQGAYPLPDPRQFHCISVDSTSSQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSGSHRGGGPGHSCKCSALSTTKCSEDDEDLRMSPSSSGKDDRGLAATP", "length": 247, "header": "tr|A0A1D5PL43-1|A0A1D5PL43_CHICK Isoform 1 of GS homeobox 1 OS=Gallus gallus OX=9031 GN=GSX1 PE=3 SV=1 CANONICAL=A0A1D5PL43-1" }, "locus": { "chromosome": "1", "start_pos": 175948818, "end_pos": 175947876, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010010710.1", "url": "https://www.ensembl.org/id/ENSGALT00010010710.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010006191.1", "url": "https://www.ensembl.org/id/ENSGALP00010006191.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:107052208", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:107052208", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "G3V634-1", "protein_name": "GS homeobox 1", "gene_name": "Gsx1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPRSFLVDSLVLREASDKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSVSPGVAHSPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP", "length": 261 }, "evidence": [ { "id": "A0A1D5PL43", "url": "https://omabrowser.org/oma/group/A0A1D5PL43/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P31315-1", "protein_name": "GS homeobox 1", "gene_name": "Gsx1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPRSFLVDSLVLREASDKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP", "length": 261 }, "evidence": [ { "id": "A0A1D5PL43", "url": "https://omabrowser.org/oma/group/A0A1D5PL43/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q5QHS3-1", "protein_name": "GS homeobox 1", "gene_name": "gsx1", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MPRSFLVDSLILRENSEKGTENSPPLFPYAVHPSHPLHSLSAGSCHSRKAGLLCFCPLCVTSQLHPSPPALPLIKASFPAFGTQYCHSALSRQHSTSSGVNLNSGSGLYQAAYPVPDPRQFHCISIENSSSQLQSSKRMRTAFTSTQLLELEREFTSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSGSHRTGAHNCKCSSSLSSARCSEEEDDLPMSPPSSEKEDADLSVSP", "length": 243 }, "evidence": [ { "id": "A0A1D5PL43", "url": "https://omabrowser.org/oma/group/A0A1D5PL43/", "database": "OMA" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q9H4S2-1", "protein_name": "GS homeobox 1", "gene_name": "GSX1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGGAGGGGSAPQGCKCASLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP", "length": 264 }, "evidence": [ { "id": "A0A1D5PL43", "url": "https://omabrowser.org/oma/group/A0A1D5PL43/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "adenohypophysis development", "id": "GO:0021984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021984", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" }, { "name": "central nervous system development", "id": "GO:0007417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007417", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" }, { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" }, { "name": "neuron differentiation", "id": "GO:0030182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030182", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" }, { "name": "transcription by RNA polymerase II", "id": "GO:0006366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" }, { "name": "spinal cord association neuron differentiation", "id": "GO:0021527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021527", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" }, { "name": "neuron fate commitment", "id": "GO:0048663", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048663", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" }, { "name": "hypothalamus development", "id": "GO:0021854", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021854", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PL43", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PL43" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 177, "end_pos": 179, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PL43-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 247, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PL43-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A1D5PL43" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 177, "end_pos": 179 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }