{ "uniprot_canonical_ac": "A0A1D5PKC2-1", "uniprot_ac": "A0A1D5PKC2", "uniprot_id": "A0A1D5PKC2_CHICK", "mass": { "chemical_mass": 24083.0, "monoisotopic_mass": 24083.0 }, "refseq": { "ac": "NP_001265279", "name": "thymidylate kinase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265279" }, "gene_names": [ { "name": "DTYMK", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2", "id": "A0A1D5PKC2" }, { "name": "DTYMK", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265279", "id": "NP_001265279" } ], "protein_names": [ { "name": "Thymidylate kinase", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2/entry#names_and_taxonomy", "id": "A0A1D5PKC2" }, { "name": "2.7.4.9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2/entry#names_and_taxonomy", "id": "A0A1D5PKC2" }, { "name": "dTMP kinase", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2/entry#names_and_taxonomy", "id": "A0A1D5PKC2" }, { "name": "deoxythymidylate kinase (thymidylate kinase)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265279", "id": "NP_001265279" }, { "name": "thymidylate kinase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265279", "id": "NP_001265279" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: BX935908.2, BU112483.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000240.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data from different strains because no single transcript from the same strain was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data.", "evidence": [ { "database": "RefSeq", "id": "NP_001265279", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265279" } ] }, { "annotation": "Catalyzes the phosphorylation of thymidine monophosphate (dTMP) to thymidine diphosphate (dTDP), the immediate precursor for the DNA building block dTTP, with ATP as the preferred phosphoryl donor in the presence of Mg(2+).", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2#function" }, { "database": "UniProtKB", "id": "ARBA00056272", "url": "https://www.uniprot.org/uniprotkb/ARBA00056272#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "DTYMK", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2", "locus": { "chromosome": "9", "start_pos": 4453831, "end_pos": 4439006, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010024900", "url": "https://www.ensembl.org/id/ENSGALG00010024900" } ] } } ], "crossref": [ { "id": "A0A1D5PKC2", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PKC2", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000006305", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000006305", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01672", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01672", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "770258", "url": "https://www.ncbi.nlm.nih.gov/gene/770258", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR018094", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018094", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018095", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018095", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039430", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039430", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:770258", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:770258", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YWHQFDA", "url": "https://omabrowser.org/oma/group/YWHQFDA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PKC2", "url": "https://www.orthodb.org/?gene=A0A1D5PKC2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A8V0ZVI3", "url": "https://www.orthodb.org/?gene=A0A8V0ZVI3", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A8V1A2Y4", "url": "https://www.orthodb.org/?gene=A0A8V1A2Y4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A8V1A2Y9", "url": "https://www.orthodb.org/?gene=A0A8V1A2Y9", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10344", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10344", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10344:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10344:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02223", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02223", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-499943", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001265279", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265279", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "13517", "url": "https://www.rhea-db.org/rhea/13517", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PKC2-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0ZVI3", "url": "https://www.uniprot.org/uniprotkb/A0A8V0ZVI3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0ZVI3-1", "url": "https://www.uniprot.org/uniprotkb/A0A8V0ZVI3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V1A2Y4", "url": "https://www.uniprot.org/uniprotkb/A0A8V1A2Y4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V1A2Y4-1", "url": "https://www.uniprot.org/uniprotkb/A0A8V1A2Y4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V1A2Y9", "url": "https://www.uniprot.org/uniprotkb/A0A8V1A2Y9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V1A2Y9-1", "url": "https://www.uniprot.org/uniprotkb/A0A8V1A2Y9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGGRGALIVLEGMDRAGKSTQCRRLVQALQAAGHRADLLRFPERTTEIGQLISAYLARERELEDHAVHLLFSANRWEHVTLMKEKLHQGITLVVDRYAFSGVAFTSAKENFCLEWCKQTDAGLPKPDLILFLQLSPEEAAARGNFGGERYENGAFQEKVLQSFRHLMKEKTLNWKTMDASKSIEDLHREIKTVAEKTMQEVKDEPLGELWK", "length": 212, "header": "tr|A0A1D5PKC2-1|A0A1D5PKC2_CHICK Isoform 1 of Thymidylate kinase OS=Gallus gallus OX=9031 GN=DTYMK PE=1 SV=1 CANONICAL=A0A1D5PKC2-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PKC2-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2/entry#A0A1D5PKC2-1", "sequence": { "sequence": "MAGGRGALIVLEGMDRAGKSTQCRRLVQALQAAGHRADLLRFPERTTEIGQLISAYLARERELEDHAVHLLFSANRWEHVTLMKEKLHQGITLVVDRYAFSGVAFTSAKENFCLEWCKQTDAGLPKPDLILFLQLSPEEAAARGNFGGERYENGAFQEKVLQSFRHLMKEKTLNWKTMDASKSIEDLHREIKTVAEKTMQEVKDEPLGELWK", "length": 212, "header": "tr|A0A1D5PKC2-1|A0A1D5PKC2_CHICK Isoform 1 of Thymidylate kinase OS=Gallus gallus OX=9031 GN=DTYMK PE=1 SV=1 CANONICAL=A0A1D5PKC2-1" }, "locus": { "chromosome": "9", "start_pos": 4444911, "end_pos": 4439982, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010060807.1", "url": "https://www.ensembl.org/id/ENSGALT00010060807.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010037566.1", "url": "https://www.ensembl.org/id/ENSGALP00010037566.1" } ] } }, { "isoform_ac": "A0A8V0ZVI3-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2/entry#A0A8V0ZVI3-1", "sequence": { "sequence": "MVPRCLERRWREGEAVRKSGQNGGRTRRVDCAGRDGPCREEHAVPAAGSGPAGRRAPRRSPPLPGTLMKEKLHQGITLVVDRYAFSGVAFTSAKENFCLEWCKQTDAGLPKPDLILFLQLSPEEAAARGNFGGERYENGAFQEKVLQSFRHLMKEKTLNWKTMDASKSIEDLHREIKTVAEKTMQEVKDEPLGELWK", "length": 197, "header": "tr|A0A8V0ZVI3-1|A0A1D5PKC2_CHICK Computationally mapped isoform of Thymidylate kinase OS=Gallus gallus OX=9031 GN=DTYMK PE=1 SV=1 CANONICAL=A0A1D5PKC2-1" }, "locus": { "chromosome": "9", "start_pos": 4444911, "end_pos": 4439918, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010060809.1", "url": "https://www.ensembl.org/id/ENSGALT00010060809.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010037568.1", "url": "https://www.ensembl.org/id/ENSGALP00010037568.1" } ] } }, { "isoform_ac": "A0A8V1A2Y4-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2/entry#A0A8V1A2Y4-1", "sequence": { "sequence": "MAGGRGALIVLEGMDRAGKSTQCRRLVQALQAAGHRADLLRFPGMGLWVRGAPLRGAAGPPTFGPLAYREDDGDRAADQCLPGEGEGAGGPRRAPAVLRQPLGARVKGGKGTRGLGEPGCGGHRSGAAGPGAGCGVPAKGLAPEGGCAGRGLLKERGCVATRASPFPFQP", "length": 170, "header": "tr|A0A8V1A2Y4-1|A0A1D5PKC2_CHICK Computationally mapped isoform of Thymidylate kinase OS=Gallus gallus OX=9031 GN=DTYMK PE=1 SV=1 CANONICAL=A0A1D5PKC2-1" }, "locus": { "chromosome": "9", "start_pos": 4441942, "end_pos": 4441654, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010060803.1", "url": "https://www.ensembl.org/id/ENSGALT00010060803.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010037562.1", "url": "https://www.ensembl.org/id/ENSGALP00010037562.1" } ] } }, { "isoform_ac": "A0A8V1A2Y9-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2/entry#A0A8V1A2Y9-1", "sequence": { "sequence": "VCLAPNPATPGQAFRGRQKSKRSKLENEQRVSVRYLRQIQQQDEQSRAAASRAQQPRRSPLTAAAQRPRSPSRRSAWPAALCRRCTPCIYCRRSGSSSGAPPAARLTCSSPTRCTRRPGGRFRLSYLYSADSAHTRERAASPEAAYPPPPPRLSAAREDPHTPSVLWSSSRISWKFRCSSHGRFSMPETNTQRHQGRSPHGRPTRGLPALPPSPLGPVAQRGSRPAAAPRSLSRTLMKEKLHQGITLVVDRYAFSGVAFTSAKENFCLEWCKQTDAGLPKPDLILFLQLSPEEAAARGNFGGERYENGAFQEKVLQSFRHLMKEKTLNWKTMDASKSIEDLHREIKTVAEKTMQEVKDEPLGELWK", "length": 366, "header": "tr|A0A8V1A2Y9-1|A0A1D5PKC2_CHICK Computationally mapped isoform of Thymidylate kinase OS=Gallus gallus OX=9031 GN=DTYMK PE=1 SV=1 CANONICAL=A0A1D5PKC2-1" }, "locus": { "chromosome": "9", "start_pos": 4444911, "end_pos": 4439008, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010060808.1", "url": "https://www.ensembl.org/id/ENSGALT00010060808.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010037567.1", "url": "https://www.ensembl.org/id/ENSGALP00010037567.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "gga:770258", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:770258", "resource": "KEGG Pathway" }, { "id": "R-GGA-499943", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-499943", "resource": "Reactome", "description": "Interconversion of nucleotide di- and triphosphates" } ], "orthologs": [ { "uniprot_canonical_ac": "A1ZB29-1", "protein_name": "Thymidylate kinase", "gene_name": "TMPK", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSAGKRGALIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINSYLTNSKDLPDEVIHLMFSANRWEHINQVKEKLLEGTTLVVDRYSFSGVAYSAAKGLDFDWCYAPERGLIKPDAVFYLRAPPNDLTHRGQYGKERYEKVEFQGRVAEVFNRICSKEGSYFHQFDARQSVEDLHAQIASITEELLPKVATRPLDTLS", "length": 211 }, "evidence": [ { "id": "A0A1D5PKC2", "url": "https://omabrowser.org/oma/group/A0A1D5PKC2/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P00572-1", "protein_name": "Thymidylate kinase", "gene_name": "CDC8", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MMGRGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGLINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDLDWCLQPDVGLLKPDLTLFLSTQDVDNNAEKSGFGDERYETVKFQEKVKQTFMKLLDKEIRKGDESITIVDVTNKGIQEVEALIWQIVEPVLSTHIDHDKFSFF", "length": 216 }, "evidence": [ { "id": "A0A1D5PKC2", "url": "https://omabrowser.org/oma/group/A0A1D5PKC2/", "database": "OMA" } ], "glygen_name": "Yeast", "common_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23919-1", "protein_name": "Thymidylate kinase", "gene_name": "DTYMK", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK", "length": 212 }, "evidence": [ { "id": "A0A1D5PKC2", "url": "https://omabrowser.org/oma/group/A0A1D5PKC2/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P97930-1", "protein_name": "Thymidylate kinase", "gene_name": "Dtymk", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASRRGALIVLEGVDRAGKTTQGLKLVTALCASGHRAELLRFPERSTEIGKLLNSYLEKKTELEDHSVHLLFSANRWEQVPLIKAKLNQGVTLVLDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLILFLQLQLLDAAARGEFGLERYETGTFQKQVLLCFQQLMEEKNLNWKVVDASKSIEEVHKEIRAHSEDAIRNAAQRPLGELWK", "length": 212 }, "evidence": [ { "id": "A0A1D5PKC2", "url": "https://omabrowser.org/oma/group/A0A1D5PKC2/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q3B752-1", "protein_name": "Thymidylate kinase", "gene_name": "dtymk", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MSCRRGALIVLEGVDRAGKTTQCQKLVQAIQQSGRAAEIMRFPDRTTKIGQLISSYLEKKSNLEDHTVHLLFSANRWEMVPVMKQKLEEGINLVVDRYAFSGVAFTSAKPGFSLEWCMNPDVGLPKPDLVMFLQLNPNVAANRGEYGNERYETSAFQRTVQQRFEELMQDTSINWKVIDAARTIEEVHKDIKDLSENIISLAEEQPVGELWR", "length": 212 }, "evidence": [ { "id": "A0A1D5PKC2", "url": "https://omabrowser.org/oma/group/A0A1D5PKC2/", "database": "OMA" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ], "pmid": "" }, { "name": "dTMP kinase activity", "id": "GO:0004798", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004798", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ], "pmid": "" }, { "name": "nucleoside diphosphate kinase activity", "id": "GO:0004550", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004550", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "dTDP biosynthetic process", "id": "GO:0006233", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006233", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ], "pmid": "" }, { "name": "dUDP biosynthetic process", "id": "GO:0006227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006227", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ], "pmid": "" }, { "name": "dTTP biosynthetic process", "id": "GO:0006235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006235", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PKC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "13517", "name": "", "equation": "dTMP + ATP = dTDP + ADP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "R4GJC4-1", "A0A1D5PKC2-1" ], "evidence": [ { "id": "13517", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/13517" } ] }, { "id": "R-GGA-73635", "name": "dUMP or TMP + ATP <=> dUDP or TDP + ADP [DTYMK]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5PKC2-1" ], "evidence": [ { "id": "R-GGA-73635", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-73635" } ] }, { "id": "R-GGA-75126", "name": "dUDP or TDP + ADP <=> dUMP or TMP + ATP [DTYMK]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A1D5PKC2-1" ], "evidence": [ { "id": "R-GGA-75126", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-75126" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A1D5PKC2", "gene_name": "DTYMK", "activity": [ { "ec_number": "2.7.4.9", "activity": "dTMP + ATP = dTDP + ADP.", "evidence": [ { "id": "A0A1D5PKC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ] }, { "ec_number": "2.7.4.9", "activity": "", "evidence": [ { "id": "A0A1D5PKC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PKC2" } ] } ] }, { "uniprot_ac": "R4GJC4", "gene_name": "CMPK2", "activity": [ { "ec_number": "2.7.4.9", "activity": "dTMP + ATP = dTDP + ADP.", "evidence": [ { "id": "R4GJC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/R4GJC4" } ] }, { "ec_number": "2.7.4.14", "activity": "UMP + ATP = UDP + ADP.", "evidence": [ { "id": "R4GJC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/R4GJC4" } ] }, { "ec_number": "2.7.4.9", "activity": "", "evidence": [ { "id": "R4GJC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/R4GJC4" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "R4GJC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/R4GJC4" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PKC2-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 212, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PKC2-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A1D5PKC2" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "2.7.4.9", "ec_name": "dTMP + ATP = dTDP + ADP.", "evidence": [ { "id": "2.7.4.9", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.7.4.9" }, { "id": "2.7.4.9", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.4.9" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }