{ "uniprot_canonical_ac": "A0A1D5PIT2-1", "uniprot_ac": "A0A1D5PIT2", "uniprot_id": "A0A1D5PIT2_CHICK", "mass": { "chemical_mass": 21465.0, "monoisotopic_mass": 21465.0 }, "refseq": { "ac": "XP_418913", "name": "neurensin-1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_418913" }, "gene_names": [ { "name": "NRSN1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2", "id": "A0A1D5PIT2" }, { "name": "NRSN1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_418913", "id": "XP_418913" } ], "protein_names": [ { "name": "Neurensin 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2/entry#names_and_taxonomy", "id": "A0A1D5PIT2" }, { "name": "neurensin-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_418913", "id": "XP_418913" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052533.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Nov 16, 2006 this sequence version replaced XP_418913.1. COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_418913", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_418913" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PIT2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "NRSN1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2", "locus": { "chromosome": "2", "start_pos": 57666400, "end_pos": 57673494, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010008072", "url": "https://www.ensembl.org/id/ENSGALG00010008072" } ] } } ], "crossref": [ { "id": "A0A1D5PIT2", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PIT2", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000037811", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000037811", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "420822", "url": "https://www.ncbi.nlm.nih.gov/gene/420822", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR024883", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024883", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ASIWEHE", "url": "https://omabrowser.org/oma/group/ASIWEHE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PIT2", "url": "https://www.orthodb.org/?gene=A0A1D5PIT2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A8V0XVS6", "url": "https://www.orthodb.org/?gene=A0A8V0XVS6", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14796", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14796", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14796:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14796:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF14927", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF14927", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_418913", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_418913", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PIT2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PIT2-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0XVS6", "url": "https://www.uniprot.org/uniprotkb/A0A8V0XVS6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0XVS6-1", "url": "https://www.uniprot.org/uniprotkb/A0A8V0XVS6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSYADICGSKHAQGSTEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPSRWSSAFWKVGLVSGTAFMLIGLMVLVVGFLVPPKIEALGKDDFVVVDTRAIQFNGSLDICKLSGAILFCIGGTAMAACLLMAAFAKSYSKEEKYLQQRFKERIADIKTHANPVTKAPAPGESKIPVTLSKVQNVQPVSQT", "length": 195, "header": "tr|A0A1D5PIT2-1|A0A1D5PIT2_CHICK Isoform 1 of Neurensin 1 OS=Gallus gallus OX=9031 GN=NRSN1 PE=4 SV=1 CANONICAL=A0A1D5PIT2-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PIT2-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2/entry#A0A1D5PIT2-1", "sequence": { "sequence": "MSSYADICGSKHAQGSTEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPSRWSSAFWKVGLVSGTAFMLIGLMVLVVGFLVPPKIEALGKDDFVVVDTRAIQFNGSLDICKLSGAILFCIGGTAMAACLLMAAFAKSYSKEEKYLQQRFKERIADIKTHANPVTKAPAPGESKIPVTLSKVQNVQPVSQT", "length": 195, "header": "tr|A0A1D5PIT2-1|A0A1D5PIT2_CHICK Isoform 1 of Neurensin 1 OS=Gallus gallus OX=9031 GN=NRSN1 PE=4 SV=1 CANONICAL=A0A1D5PIT2-1" }, "locus": { "chromosome": "2", "start_pos": 57669288, "end_pos": 57667748, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010019247.1", "url": "https://www.ensembl.org/id/ENSGALT00010019247.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010010795.1", "url": "https://www.ensembl.org/id/ENSGALP00010010795.1" } ] } }, { "isoform_ac": "A0A8V0XVS6-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2/entry#A0A8V0XVS6-1", "sequence": { "sequence": "MCFLQAGRMSSYADICGSKHAQGSTEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPSRWSSAFWKVGLVSGTAFMLIGLMVLVVGFLVPPKIEALGKDDFVVVDTRAIQFNGSLDICKLSGAILFCIGGTAMAACLLMAAFAKSYSKEEKYLQQRFKERIADIKTHANPVTKAPAPGESKIPVTLSKVQNVQPVSQT", "length": 203, "header": "tr|A0A8V0XVS6-1|A0A8V0XVS6_CHICK Computationally mapped isoform of Neurensin 1 OS=Gallus gallus OX=9031 GN=NRSN1 PE=4 SV=1 CANONICAL=A0A1D5PIT2-1" }, "locus": { "chromosome": "2", "start_pos": 57671661, "end_pos": 57667748, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010019244.1", "url": "https://www.ensembl.org/id/ENSGALT00010019244.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010010792.1", "url": "https://www.ensembl.org/id/ENSGALP00010010792.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A287AW45-1", "protein_name": "Neurensin 1", "gene_name": "NRSN1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MVAGPETGRGHWELGRMSSCSNICGSKQAQAATESGYQRYGVRSYLHQFYEDCTTSIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEANFVVVDTHAVQFNGALDMCKLAGAVLFCIGGMSMAGCLLMSVFAKSYSKEEKILQQKFKERIADIKAHPQPITRAPGPGETKIPVTLSRVQNVQPVSAT", "length": 211 }, "evidence": [ { "id": "A0A1D5PIT2", "url": "https://omabrowser.org/oma/group/A0A1D5PIT2/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "G3IAE7-1", "protein_name": "Neurensin-1", "gene_name": "Nrsn1", "tax_id": 10029, "organism": "Cricetulus griseus", "sequence": { "sequence": "MTSCSNTCGSKQTQADTEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVIFGLTVLAVGFLVPPKIEAFGEADFMVVDTHAVQFNGALDTCKLAGAVLFCIGGTSMAGCLLMSVFAKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGDTKIPVTLSRVQNVQPLSAT", "length": 195 }, "evidence": [ { "id": "A0A1D5PIT2", "url": "https://omabrowser.org/oma/group/A0A1D5PIT2/", "database": "OMA" } ], "glygen_name": "Hamster", "common_name": "Chinese hamster" }, { "uniprot_canonical_ac": "G3V892-1", "protein_name": "Neurensin 1", "gene_name": "Nrsn1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTSCSNTCGSRQAQADTEGGYQRRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVVLGLTVLAVGFLVPPKIEAFGEADFMVVDTHAVQYNGALDTCKLVGAVLFCIGGTSMAGCLLMSVFAKSYSKEEKFLQQKFKERIADIKAHTQPITKTPGPGDTKIPVTLSRVQNVQPLTAT", "length": 196 }, "evidence": [ { "id": "A0A1D5PIT2", "url": "https://omabrowser.org/oma/group/A0A1D5PIT2/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P97799-1", "protein_name": "Neurensin-1", "gene_name": "Nrsn1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTSCSNTCGSRRAQADTEGGYQQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFMVVDTHAVKYNGALDTCKLAGAVLFCIGGTSMAGCLLMSVFAKSYSKEEKFLQQKFKERIADIKAHTQPITKAPGPGDTKIPVTLSRVQNVQPLSAT", "length": 196 }, "evidence": [ { "id": "A0A1D5PIT2", "url": "https://omabrowser.org/oma/group/A0A1D5PIT2/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q0VD08-1", "protein_name": "Neurensin 1", "gene_name": "NRSN1", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MSSCSNVCGSRQAQAATEAGHQRYGVRSYLHQFYEDCTTSIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEANFVVVDTHAVQFNGALDMCKLAGAVLFCIGGTSMAGCLLMSVSAKSYSKEEKFLQQRFKERIADIKAHTQPITRAPGPGETKIPVTLSRVHNVQPLAAT", "length": 195 }, "evidence": [ { "id": "A0A1D5PIT2", "url": "https://omabrowser.org/oma/group/A0A1D5PIT2/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q6P976-1", "protein_name": "Zgc:73062", "gene_name": "nrsn1", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MTSCSEICGSDYAEQTHGAVSSGYQGYGVRSYLHQFYEECTASIWERDEDFQTQRSASRWSSVLWKVCLALGALILVAGLSVLLVGYATPPRLEAFGEDELLFVDGRAVRFNRALDACKLAGAVLFCVGGSGMAVGLLLAACSQNSSKEELRLQQRFKERLAEIQASVQPVTRAPTPGDAKVPVTLSKVQNVQPGAET", "length": 198 }, "evidence": [ { "id": "A0A1D5PIT2", "url": "https://omabrowser.org/oma/group/A0A1D5PIT2/", "database": "OMA" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q8IZ57-1", "protein_name": "Neurensin-1", "gene_name": "NRSN1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFVKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT", "length": 195 }, "evidence": [ { "id": "A0A1D5PIT2", "url": "https://omabrowser.org/oma/group/A0A1D5PIT2/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "transport vesicle", "id": "GO:0030133", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030133", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PIT2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PIT2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2" } ], "pmid": "" }, { "name": "growth cone", "id": "GO:0030426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PIT2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PIT2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PIT2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PIT2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PIT2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 109, "end_pos": 111, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 109, "end_pos": 111 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }