{ "uniprot_canonical_ac": "A0A1D5PHP9-1", "uniprot_ac": "A0A1D5PHP9", "uniprot_id": "A0A1D5PHP9_CHICK", "mass": { "chemical_mass": 40591.0, "monoisotopic_mass": 40591.0 }, "refseq": { "ac": "NP_001186536", "name": "wnt inhibitory factor 1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186536" }, "gene_names": [ { "name": "WIF1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9", "id": "A0A1D5PHP9" }, { "name": "WIF1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186536", "id": "NP_001186536" } ], "protein_names": [ { "name": "Wnt inhibitory factor 1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9/entry#names_and_taxonomy", "id": "A0A1D5PHP9" }, { "name": "Wnt inhibitory factor-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186536", "id": "NP_001186536" }, { "name": "wnt inhibitory factor 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186536", "id": "NP_001186536" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: SRR13267662.9883.1, SRR13267655.124238.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA103992290, SAMEA103992323 [ECO:0006172] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000012.1. On Mar 18, 2015 this sequence version replaced NP_001186536.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript from the same breed was available for the full length of the gene. The genomic coordinates used for the transcript record were based on alignments.", "evidence": [ { "database": "RefSeq", "id": "NP_001186536", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186536" } ] }, { "annotation": "Binds to WNT proteins and inhibits their activities. May be involved in mesoderm segmentation.", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PHP9", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9#function" }, { "database": "UniProtKB", "id": "ARBA00003309", "url": "https://www.uniprot.org/uniprotkb/ARBA00003309#function" }, { "database": "UniProtKB", "id": "A0A8V0YE64", "url": "https://www.uniprot.org/uniprotkb/A0A8V0YE64#function" }, { "database": "UniProtKB", "id": "A0A8V0YM99", "url": "https://www.uniprot.org/uniprotkb/A0A8V0YM99#function" } ] }, { "annotation": "These results identify Wif-1 as a novel extracellular Wnt modulator in cartilage biology.", "evidence": [ { "database": "RefSeq", "id": "NP_001186536", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186536" }, { "database": "PubMed", "id": "19755491", "url": "https://glygen.org/publication/PubMed/19755491" } ] }, { "annotation": "Wif1 is a modulator of cardiomyocyte differentiation Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001186536", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186536" }, { "database": "PubMed", "id": "21179454", "url": "https://glygen.org/publication/PubMed/21179454" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PHP9", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "WIF1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9", "locus": { "chromosome": "1", "start_pos": 34008783, "end_pos": 34051762, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010012361", "url": "https://www.ensembl.org/id/ENSGALG00010012361" } ] } } ], "crossref": [ { "id": "A0A1D5PHP9", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PHP9", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000039209", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000039209", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00054", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00054", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "417831", "url": "https://www.ncbi.nlm.nih.gov/gene/417831", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003306", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003306", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013032", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013032", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013309", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013309", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050969", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050969", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:417831", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:417831", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CKKALCY", "url": "https://omabrowser.org/oma/group/CKKALCY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PHP9", "url": "https://www.orthodb.org/?gene=A0A1D5PHP9", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A8V0YE64", "url": "https://www.orthodb.org/?gene=A0A8V0YE64", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A8V0YM99", "url": "https://www.orthodb.org/?gene=A0A8V0YM99", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14949", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14949", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14949:SF32", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14949:SF32", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02019", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02019", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12661", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12661", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001186536", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186536", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PHP9", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PHP9-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0YE64", "url": "https://www.uniprot.org/uniprotkb/A0A8V0YE64", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0YE64-1", "url": "https://www.uniprot.org/uniprotkb/A0A8V0YE64-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0YM99", "url": "https://www.uniprot.org/uniprotkb/A0A8V0YM99", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V0YM99-1", "url": "https://www.uniprot.org/uniprotkb/A0A8V0YM99-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAAGRLCAALLCGALSLCGVRAAARQPDTLYLWIDAQQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVGIHAMNFSWQATGRAEYFYEFLSLRSLDKGIMADPTVNIPLLGMVPHKPSVVQVGFPCLGKQDGVAAFEVNVIIMNAEGNIILQTPQNAIFFKTCQQAECPGGCRNGGFCNERHVCECPDGFYGPHCEKALCAPRCMNGGLCITPGLCICPPGFYGINCDKANCTTTCFNGGTCFYLGKCICPSGFEGDQCEISKCHQPCRNGGKCMGKNKCKCSKGYQGDLCSKPVCEPGCGLYGTCAEPNKCHCKEGWHGRHCNKRYGASSPSALRPAGTKHRQYTPSPKKAEERHAPPESNYIW", "length": 374, "header": "tr|A0A1D5PHP9-1|A0A1D5PHP9_CHICK Isoform 1 of Wnt inhibitory factor 1 OS=Gallus gallus OX=9031 GN=WIF1 PE=1 SV=1 CANONICAL=A0A1D5PHP9-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PHP9-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9/entry#A0A1D5PHP9-1", "sequence": { "sequence": "MAAAGRLCAALLCGALSLCGVRAAARQPDTLYLWIDAQQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVGIHAMNFSWQATGRAEYFYEFLSLRSLDKGIMADPTVNIPLLGMVPHKPSVVQVGFPCLGKQDGVAAFEVNVIIMNAEGNIILQTPQNAIFFKTCQQAECPGGCRNGGFCNERHVCECPDGFYGPHCEKALCAPRCMNGGLCITPGLCICPPGFYGINCDKANCTTTCFNGGTCFYLGKCICPSGFEGDQCEISKCHQPCRNGGKCMGKNKCKCSKGYQGDLCSKPVCEPGCGLYGTCAEPNKCHCKEGWHGRHCNKRYGASSPSALRPAGTKHRQYTPSPKKAEERHAPPESNYIW", "length": 374, "header": "tr|A0A1D5PHP9-1|A0A1D5PHP9_CHICK Isoform 1 of Wnt inhibitory factor 1 OS=Gallus gallus OX=9031 GN=WIF1 PE=1 SV=1 CANONICAL=A0A1D5PHP9-1" }, "locus": { "chromosome": "1", "start_pos": 34051094, "end_pos": 34010063, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010029607.1", "url": "https://www.ensembl.org/id/ENSGALT00010029607.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010017224.1", "url": "https://www.ensembl.org/id/ENSGALP00010017224.1" } ] } }, { "isoform_ac": "A0A8V0YE64-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9/entry#A0A8V0YE64-1", "sequence": { "sequence": "MAAAGRLCAALLCGALSLCGVRAAARQPDTLYLWIDAQQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVGIHAMNFSWQATGRAEYFYEFLSLRSLDKGIMADPTVNIPLLGMVPHKPSVVQVGFPCLGKQDGVAAFEVNVIIMNAEGNIILQTPQNAIFFKTCQQALCAPRCMNGGLCITPGLCICPPGFYGINCDKANCTTTCFNGGTCFYLGKCICPSGFEGDQCEISKCHQPCRNGGKCMGKNKCKCSKGYQGDLCSKPVCEPGCGLYGTCAEPNKCHCKEGWHGRHCNKRYGASSPSALRPAGTKHRQYTPSPKKAEERHAPPESNYIW", "length": 342, "header": "tr|A0A8V0YE64-1|A0A1D5PHP9_CHICK Computationally mapped isoform of Wnt inhibitory factor 1 OS=Gallus gallus OX=9031 GN=WIF1 PE=1 SV=1 CANONICAL=A0A1D5PHP9-1" }, "locus": { "chromosome": "1", "start_pos": 34051094, "end_pos": 34010063, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010029598.1", "url": "https://www.ensembl.org/id/ENSGALT00010029598.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010017219.1", "url": "https://www.ensembl.org/id/ENSGALP00010017219.1" } ] } }, { "isoform_ac": "A0A8V0YM99-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9/entry#A0A8V0YM99-1", "sequence": { "sequence": "MRAGAGCPERLWMPRPWRCSRPGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVGIHAMNFSWQATGRAEYFYEFLSLRSLDKGIMADPTVNIPLLGMVPHKPSVVQVGFPCLGKQDGVAAFEVNVIIMNAEGNIILQTPQNAIFFKTCQQAECPGGCRNGGFCNERHVCECPDGFYGPHCEKALCAPRCMNGGLCITPGLCICPPGFYGINCDKANCTTTCFNGGTCFYLGKCICPSGFEGDQCEISKCHQPCRNGGKCMGKNKCKCSKGYQGDLCSKPVCEPGCGLYGTCAEPNKCHCKEGWHGRHCNKRYGASSPSALRPAGTKHRQYTPSPKKAEERHAPPESNYIW", "length": 352, "header": "tr|A0A8V0YM99-1|A0A8V0YM99_CHICK Computationally mapped isoform of Wnt inhibitory factor 1 OS=Gallus gallus OX=9031 GN=WIF1 PE=1 SV=1 CANONICAL=A0A1D5PHP9-1" }, "locus": { "chromosome": "1", "start_pos": 34051714, "end_pos": 34010063, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010029610.1", "url": "https://www.ensembl.org/id/ENSGALT00010029610.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010017226.1", "url": "https://www.ensembl.org/id/ENSGALP00010017226.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Wif-1 is expressed at cartilage-mesenchyme interfaces and impedes Wnt3a-mediated inhibition of chondrogenesis.", "journal": "Journal of cell science", "date": "2009", "authors": "Surmann-Schmitt C, Widmann N, Dietz U, Saeger B, Eitzinger N, Nakamura Y, Rattel M, Latham R, Hartmann C, von der Mark H, Schett G, von der Mark K, Stock M", "evidence": [ { "database": "RefSeq", "id": "NP_001186536", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186536" } ], "reference": [ { "type": "PubMed", "id": "19755491", "url": "https://glygen.org/publication/PubMed/19755491" } ] }, { "title": "Comprehensive gene-expression survey identifies wif1 as a modulator of cardiomyocyte differentiation.", "journal": "PloS one", "date": "2010-12-13", "authors": "Buermans Henk P J, van Wijk Bram, Hulsker Margriet A, Smit Niels C H, den Dunnen Johan T, van Ommen Gertjan B, Moorman Antoon F, van den Hoff Maurice J, 't Hoen Peter A C", "evidence": [ { "database": "RefSeq", "id": "NP_001186536", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186536" } ], "reference": [ { "type": "PubMed", "id": "21179454", "url": "https://glygen.org/publication/PubMed/21179454" } ] } ], "pathway": [ { "id": "gga:417831", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:417831", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "E1BNM8-1", "protein_name": "Wnt inhibitory factor 1", "gene_name": "WIF1", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MARKSAFPAGALWLWSILPCLLVLRAEVGQQPEESLYLWIDAHQARVLIGLEEDILIVSEGKMAPFTHDFRRAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCECPDGFYGPHCEKVLCSPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSATCFNGGTCFYPGKCICPPGLEGEQCETSKCPQPCRNGGKCIGKNKCKCSKGYQGDLCSKPVCKPGCGTHGTCHEPNKCQCREGWHGRHCNKRYGASLLHTLRPAGAQLRQHTPSVKKAEERQDPPESNYIW", "length": 379 }, "evidence": [ { "id": "A0A1D5PHP9", "url": "https://omabrowser.org/oma/group/A0A1D5PHP9/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "K7GQ27-1", "protein_name": "Wnt inhibitory factor 1", "gene_name": "WIF1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MASRSAFAAAALQLWSILPCLLVLRAEVGQPPEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGRAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNAILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFYGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRYCNKRYGASLMHALRPAGARLRQHTPSLKKAEERQDPPESNYIW", "length": 379 }, "evidence": [ { "id": "A0A1D5PHP9", "url": "https://omabrowser.org/oma/group/A0A1D5PHP9/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q9WUA1-1", "protein_name": "Wnt inhibitory factor 1", "gene_name": "Wif1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARRRAFPAFALRLWSILPCLLLLRADAGQPPEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILRTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCECPDGFYGPHCEKALCIPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCELSKCPQPCRNGGKCIGKSKCKCPKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCREGWHGRHCNKRYGASLMHAPRPAGAGLERHTPSLKKAEDRRDPPESNYIW", "length": 379 }, "evidence": [ { "id": "A0A1D5PHP9", "url": "https://omabrowser.org/oma/group/A0A1D5PHP9/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y5W5-1", "protein_name": "Wnt inhibitory factor 1", "gene_name": "WIF1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW", "length": 379 }, "evidence": [ { "id": "A0A1D5PHP9", "url": "https://omabrowser.org/oma/group/A0A1D5PHP9/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PHP9", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PHP9", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "Wnt signaling pathway", "id": "GO:0016055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016055", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PHP9", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9" } ], "pmid": "" }, { "name": "positive regulation of fat cell differentiation", "id": "GO:0045600", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045600", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PHP9", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PHP9", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PHP9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 240, "end_pos": 242, "annotation": "n_glycosylation_sequon" }, { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PHP9-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 374, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PHP9-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A1D5PHP9" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 240, "end_pos": 242 }, { "start_pos": 83, "end_pos": 85 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }