{ "uniprot_canonical_ac": "A0A1D5PAM4-1", "uniprot_ac": "A0A1D5PAM4", "uniprot_id": "A0A1D5PAM4_CHICK", "mass": { "chemical_mass": 8559.0, "monoisotopic_mass": 8559.0 }, "refseq": { "ac": "NP_001106280", "name": "heat shock factor-binding protein 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106280" }, "gene_names": [ { "name": "HSBP1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4", "id": "A0A1D5PAM4" }, { "name": "HSBP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106280", "id": "NP_001106280" } ], "protein_names": [ { "name": "Heat shock factor-binding protein 1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4/entry#names_and_taxonomy", "id": "A0A1D5PAM4" }, { "name": "heat shock factor-binding protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106280", "id": "NP_001106280" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: HAEK01005768.1, HAEK01105972.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMN02738227 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000248.1. On Dec 28, 2007 this sequence version replaced XP_414175.2.", "evidence": [ { "database": "RefSeq", "id": "NP_001106280", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106280" } ] }, { "annotation": "Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PAM4", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4#function" }, { "database": "UniProtKB", "id": "ARBA00037689", "url": "https://www.uniprot.org/uniprotkb/ARBA00037689#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PAM4", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "HSBP1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4", "locus": { "chromosome": "11", "start_pos": 16273031, "end_pos": 16275586, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010007548", "url": "https://www.ensembl.org/id/ENSGALG00010007548" } ] } } ], "crossref": [ { "id": "A0A1D5PAM4", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PAM4", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000043039", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000043039", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "415813", "url": "https://www.ncbi.nlm.nih.gov/gene/415813", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR009643", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009643", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:415813", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:415813", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MERANMD", "url": "https://omabrowser.org/oma/group/MERANMD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PAM4", "url": "https://www.orthodb.org/?gene=A0A1D5PAM4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19424", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19424", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19424:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19424:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06825", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF06825", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-3371568", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-3371568", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-3371571", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-3371571", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001106280", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106280", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PAM4", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PAM4-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAETDPKTVQDLTAVVQTLLQQMQDKFQTMSDQIIGRIDDMSCRIDDLEKNIADLMTQAGVEELEGENKAPATTNKS", "length": 77, "header": "tr|A0A1D5PAM4-1|A0A1D5PAM4_CHICK Isoform 1 of Heat shock factor-binding protein 1 OS=Gallus gallus OX=9031 GN=HSBP1 PE=1 SV=1 CANONICAL=A0A1D5PAM4-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PAM4-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4/entry#A0A1D5PAM4-1", "sequence": { "sequence": "MAETDPKTVQDLTAVVQTLLQQMQDKFQTMSDQIIGRIDDMSCRIDDLEKNIADLMTQAGVEELEGENKAPATTNKS", "length": 77, "header": "tr|A0A1D5PAM4-1|A0A1D5PAM4_CHICK Isoform 1 of Heat shock factor-binding protein 1 OS=Gallus gallus OX=9031 GN=HSBP1 PE=1 SV=1 CANONICAL=A0A1D5PAM4-1" }, "locus": { "chromosome": "11", "start_pos": 16275544, "end_pos": 16274616, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010017976.1", "url": "https://www.ensembl.org/id/ENSGALT00010017976.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010009897.1", "url": "https://www.ensembl.org/id/ENSGALP00010009897.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:415813", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:415813", "resource": "KEGG Pathway" }, { "id": "R-GGA-3371568", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-3371568", "resource": "Reactome", "description": "Attenuation phase" }, { "id": "R-GGA-3371571", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-3371571", "resource": "Reactome", "description": "HSF1-dependent transactivation" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A287BMT8-1", "protein_name": "Heat shock factor-binding protein 1", "gene_name": "HSBP1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELEGDNKIPATQKS", "length": 76 }, "evidence": [ { "id": "A0A1D5PAM4", "url": "https://omabrowser.org/oma/group/A0A1D5PAM4/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "O75506-1", "protein_name": "Heat shock factor-binding protein 1", "gene_name": "HSBP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS", "length": 76 }, "evidence": [ { "id": "A0A1D5PAM4", "url": "https://omabrowser.org/oma/group/A0A1D5PAM4/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q3ZC22-1", "protein_name": "Heat shock factor-binding protein 1", "gene_name": "HSBP1", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELDSENKIPATQKS", "length": 76 }, "evidence": [ { "id": "A0A1D5PAM4", "url": "https://omabrowser.org/oma/group/A0A1D5PAM4/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q6PBV8-1", "protein_name": "Heat shock factor-binding protein 1", "gene_name": "hsbp1b", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MAETDPKSVQDLTAVVQTLLQQMQDKFQTMSDQIIGRIDEMSTRIDDLEKNIADLMTQAGVEEIEGENKVKEGDAS", "length": 76 }, "evidence": [ { "id": "A0A1D5PAM4", "url": "https://omabrowser.org/oma/group/A0A1D5PAM4/", "database": "OMA" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q8GW48-1", "protein_name": "Heat shock factor-binding protein", "gene_name": "HSBP", "tax_id": 3702, "organism": "Arabidopsis thaliana", "sequence": { "sequence": "MDGHDSEDTKQSTADMTAFVQNLLQQMQTRFQTMSDSIITKIDDMGGRINELEQSINDLRAEMGVEGTPPPASKSGDEPKTPASSS", "length": 86 }, "evidence": [ { "id": "A0A1D5PAM4", "url": "https://omabrowser.org/oma/group/A0A1D5PAM4/", "database": "OMA" } ], "glygen_name": "Arabidopsis", "common_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8K3X8-1", "protein_name": "Heat shock factor-binding protein 1", "gene_name": "Hsbp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAETDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELDAENKIPTAQKS", "length": 76 }, "evidence": [ { "id": "A0A1D5PAM4", "url": "https://omabrowser.org/oma/group/A0A1D5PAM4/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9CQZ1-1", "protein_name": "Heat shock factor-binding protein 1", "gene_name": "Hsbp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAETDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELDPENKIPTAQKS", "length": 76 }, "evidence": [ { "id": "A0A1D5PAM4", "url": "https://omabrowser.org/oma/group/A0A1D5PAM4/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VK90-1", "protein_name": "Heat shock factor-binding protein 1", "gene_name": "BcDNA:RE36920", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MTDLRNEMDSDLDQNYSLNSNADPKNMQELTIYVQNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQAGIEGQGPEK", "length": 86 }, "evidence": [ { "id": "A0A1D5PAM4", "url": "https://omabrowser.org/oma/group/A0A1D5PAM4/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PAM4", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PAM4", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4" } ], "pmid": "" }, { "name": "axon cytoplasm", "id": "GO:1904115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904115", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PAM4", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PAM4", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4" } ], "pmid": "" }, { "name": "transcription corepressor activity", "id": "GO:0003714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003714", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PAM4", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "axonal transport of mitochondrion", "id": "GO:0019896", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019896", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PAM4", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4" } ], "pmid": "" }, { "name": "cellular heat acclimation", "id": "GO:0070370", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070370", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PAM4", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PAM4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 75, "end_pos": 77, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PAM4-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 77, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PAM4-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A1D5PAM4" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 75, "end_pos": 77 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }