{ "uniprot_canonical_ac": "A0A1D5P910-1", "uniprot_ac": "A0A1D5P910", "uniprot_id": "A0A1D5P910_CHICK", "mass": { "chemical_mass": 34743.0, "monoisotopic_mass": 34743.0 }, "refseq": { "ac": "NP_001264278", "name": "CUE domain-containing protein 2 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264278" }, "gene_names": [ { "name": "CUEDC2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910", "id": "A0A1D5P910" }, { "name": "CUEDC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264278", "id": "NP_001264278" } ], "protein_names": [ { "name": "CUE domain containing 2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910/entry#names_and_taxonomy", "id": "A0A1D5P910" }, { "name": "CUE domain-containing protein 2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264278", "id": "NP_001264278" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: BX935832.2 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA103992290, SAMEA103992323 [ECO:0006172] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DN930132.1, BX935832.2 and BU296957.1. On or before Apr 4, 2013 this sequence version replaced XP_421635.3, XP_003641540.1. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1). Sequence Note: This RefSeq record was created from transcript data from different strains because no single transcript from the same strain was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.", "evidence": [ { "database": "RefSeq", "id": "NP_001264278", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264278" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P910", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "CUEDC2", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910", "locus": { "chromosome": "6", "start_pos": 17747401, "end_pos": 17758397, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010021025", "url": "https://www.ensembl.org/id/ENSGALG00010021025" } ] } } ], "crossref": [ { "id": "A0A1D5P910", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5P910", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000005687", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000005687", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd14367", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14367", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "423761", "url": "https://www.ncbi.nlm.nih.gov/gene/423761", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003892", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003892", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039805", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039805", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:423761", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:423761", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ICEWIYK", "url": "https://omabrowser.org/oma/group/ICEWIYK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5P910", "url": "https://www.orthodb.org/?gene=A0A1D5P910", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A1D5PPE0", "url": "https://www.orthodb.org/?gene=A0A1D5PPE0", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "E1C7R0", "url": "https://www.orthodb.org/?gene=E1C7R0", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12493", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12493", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12493:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12493:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "NP_001264278", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264278", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5P910", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5P910-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PPE0", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PPE0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PPE0-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PPE0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E1C7R0", "url": "https://www.uniprot.org/uniprotkb/E1C7R0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E1C7R0-1", "url": "https://www.uniprot.org/uniprotkb/E1C7R0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MELERIIRETLTCFIQSHIPAADLSGMDDVFFSYITGVLEELGSPESSEETFDMDTFVEMMEAYIPGFAEIQSGNVCEMMFSLSERLGEARNKEKPSQKAVESRTEVPSEDLPKGQEPGAGVCKEETLCTPTDGAGAQEGNDLKGGVELLLEMFPACTVSQAEKALAMALGNLEEAVQLIVEEKVEIGAAGASVKLSKHRLCLHQDSSPEELCLAPHFPHELDLVRPRRAPNHEELKQVILQKYMMVDSAEDQKTHRPAPPKEAPKKLIRYIDNQVVSTKGERYKDIKKPESEEMKKTYISLKPARKYKFH", "length": 311, "header": "tr|A0A1D5P910-1|A0A1D5P910_CHICK Isoform 1 of CUE domain containing 2 OS=Gallus gallus OX=9031 GN=CUEDC2 PE=3 SV=1 CANONICAL=A0A1D5P910-1" }, "isoforms": [ { "isoform_ac": "A0A1D5P910-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910/entry#A0A1D5P910-1", "sequence": { "sequence": "MELERIIRETLTCFIQSHIPAADLSGMDDVFFSYITGVLEELGSPESSEETFDMDTFVEMMEAYIPGFAEIQSGNVCEMMFSLSERLGEARNKEKPSQKAVESRTEVPSEDLPKGQEPGAGVCKEETLCTPTDGAGAQEGNDLKGGVELLLEMFPACTVSQAEKALAMALGNLEEAVQLIVEEKVEIGAAGASVKLSKHRLCLHQDSSPEELCLAPHFPHELDLVRPRRAPNHEELKQVILQKYMMVDSAEDQKTHRPAPPKEAPKKLIRYIDNQVVSTKGERYKDIKKPESEEMKKTYISLKPARKYKFH", "length": 311, "header": "tr|A0A1D5P910-1|A0A1D5P910_CHICK Isoform 1 of CUE domain containing 2 OS=Gallus gallus OX=9031 GN=CUEDC2 PE=3 SV=1 CANONICAL=A0A1D5P910-1" }, "locus": { "chromosome": "6", "start_pos": 17753658, "end_pos": 17747777, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010050865.1", "url": "https://www.ensembl.org/id/ENSGALT00010050865.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010030056.1", "url": "https://www.ensembl.org/id/ENSGALP00010030056.1" } ] } }, { "isoform_ac": "A0A1D5PPE0-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910/entry#A0A1D5PPE0-1", "sequence": { "sequence": "MELERIIRETLTCFIQSHIPAADLSGMDDVFFSYITGVLEELGSPESSEETFDMDTFVEMMEAYIPGFAEIQSGNVCEMMFSLSERLGEARNKEKPSQKAVESRTEVPSEDLPKGQEPGAGVCKEETLCTPTDGAGAQEGNDLKGGVELLLEMFPACTVSQAEKALAMALGNLEEAVQLIVEEKVEIGAAGASVKDLVRPRRAPNHEELKQVILQKYMMVDSAEDQKTHRPAPPKEAPKKLIRYIDNQVPGSTSSTDSHVLLLFSFHLTGHVWRMDVWH", "length": 279, "header": "tr|A0A1D5PPE0-1|A0A1D5PPE0_CHICK Computationally mapped isoform of CUE domain containing 2 OS=Gallus gallus OX=9031 GN=CUEDC2 PE=3 SV=2 CANONICAL=A0A1D5P910-1" }, "locus": { "chromosome": "6", "start_pos": 17753658, "end_pos": 17747707, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010050867.1", "url": "https://www.ensembl.org/id/ENSGALT00010050867.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010030058.1", "url": "https://www.ensembl.org/id/ENSGALP00010030058.1" } ] } }, { "isoform_ac": "E1C7R0-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910/entry#E1C7R0-1", "sequence": { "sequence": "MELERIIRETLTCFIQSHIPAADLSGMDDVFFSYITGVLEELGSPESSEETFDMDTFVEMMEAYIPGFAEIQSGNVCEMMFSLSERLGEARNKEKPSQKAVESRTEVPSEDLPKGQEPGAGVCKEETLCTPTDGAGAQEGNDLKGGVELLLEMFPACTVSQAEKALAMALGNLEEAVQLIVEEKVEIGAAGASVKDLVRPRRAPNHEELKQVILQKYMMVDSAEDQKTHRPAPPKEAPKKLIRYIDNQVVSTKGERYKDIKKPESEEMKKTYISLKPARKYKFH", "length": 284, "header": "tr|E1C7R0-1|E1C7R0_CHICK Computationally mapped isoform of CUE domain containing 2 OS=Gallus gallus OX=9031 GN=CUEDC2 PE=3 SV=3 CANONICAL=A0A1D5P910-1" }, "locus": { "chromosome": "6", "start_pos": 17753658, "end_pos": 17747777, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010050861.1", "url": "https://www.ensembl.org/id/ENSGALT00010050861.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010030052.1", "url": "https://www.ensembl.org/id/ENSGALP00010030052.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:423761", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:423761", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A286ZXC4-1", "protein_name": "CUE domain-containing protein 2", "gene_name": "CUEDC2", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MELERIVSTALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRSTIGDMMQKLSGQLSGARNKENLQPQSSAVQGQVSASSETLQRPENLKEETRSSPSAAGDTPDEAAGTEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPPAWDGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQIVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH", "length": 287 }, "evidence": [ { "id": "A0A1D5P910", "url": "https://omabrowser.org/oma/group/A0A1D5P910/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q95T08-1", "protein_name": "LD29354p", "gene_name": "Dmel\\CG9636", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MTNLEKQHEMVKRSLVQFISGHIPGADFSVVDEIVLSYIISILEEASQDPCFDVEGFVEMMGAYFEEFSTIDQGIICDWIYKLANELTDMEKTQENPDAVNLSLNSLSLSSIIPESKLRARNSSTSEKDELSSNSSSSGGCGGNKRSQHLSETSDGGSTDSSSSTCDYFLDETEVLQEMFPDSAIAEIKHCIAISKGDIDSATQILLHRQETNQCITDKSHTTYMKKNVIVDDNELKNRIIARYSYVDKNATQREYKPVVPKMEPRKLVRYRDNKIVSLKGERYTEIKRDEDAELKKPKKQIQP", "length": 304 }, "evidence": [ { "id": "A0A1D5P910", "url": "https://omabrowser.org/oma/group/A0A1D5P910/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9H467-1", "protein_name": "CUE domain-containing protein 2", "gene_name": "CUEDC2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH", "length": 287 }, "evidence": [ { "id": "A0A1D5P910", "url": "https://omabrowser.org/oma/group/A0A1D5P910/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P910", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P910", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910" } ], "pmid": "" }, { "name": "nuclear membrane", "id": "GO:0031965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P910", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P910", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P910", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "negative regulation of cytokine production involved in inflammatory response", "id": "GO:1900016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900016", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P910", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910" } ], "pmid": "" }, { "name": "negative regulation of macrophage cytokine production", "id": "GO:0010936", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010936", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P910", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "ubiquitin binding", "id": "GO:0043130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043130", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5P910", "url": "https://www.uniprot.org/uniprotkb/A0A1D5P910" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5P910-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 311, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5P910-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A1D5P910" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }