{ "uniprot_canonical_ac": "A0A1B0GVR7-1", "uniprot_ac": "A0A1B0GVR7", "uniprot_id": "F240C_HUMAN", "mass": { "chemical_mass": 10834.0, "monoisotopic_mass": 10834.0 }, "refseq": { "ac": "NP_001369297", "name": "protein FAM240C isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001369297" }, "gene_names": [ { "name": "FAM240C", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVR7", "id": "A0A1B0GVR7" }, { "name": "FAM240C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001369297", "id": "NP_001369297" } ], "protein_names": [ { "name": "Protein FAM240C", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVR7/entry#names_and_taxonomy", "id": "A0A1B0GVR7" }, { "name": "protein FAM240C isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001369297", "id": "NP_001369297" }, { "name": "protein FAM240C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001369297", "id": "NP_001369297" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GVR7", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVR7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "gene": [ { "name": "FAM240C", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVR7", "locus": { "chromosome": "2", "start_pos": 241893988, "end_pos": 241902551, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000216921", "url": "https://www.ensembl.org/id/ENSG00000216921" } ] } } ], "crossref": [ { "id": "HGNC:54200", "url": "https://alliancegenome.org/gene/HGNC:54200", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GVR7", "url": "https://alphafold.ebi.ac.uk/entry/A0A1B0GVR7", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSG00000216921", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216921", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FAM240C", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FAM240C", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "285095", "url": "https://www.ncbi.nlm.nih.gov/gene/285095", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "54200", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:54200", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR040261", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040261", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "QPSHARD", "url": "https://omabrowser.org/oma/group/QPSHARD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR40387", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR40387", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR40387:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR40387:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A1B0GVR7", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:PR_A0A1B0GVR7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001369297", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001369297", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1B0GUP9", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GUP9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GUP9-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GUP9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GVR7", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVR7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GVR7-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVR7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVGKNMSKSLTLKNPGRVAYDSGGIKMFWEKKIEHHARHLQNEDIRVRRSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA", "length": 95, "header": "sp|A0A1B0GVR7-1|F240C_HUMAN Isoform 1 of Protein FAM240C OS=Homo sapiens OX=9606 GN=FAM240C PE=1 SV=1 CANONICAL=A0A1B0GVR7-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GUP9-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVR7/entry#A0A1B0GUP9-1", "sequence": { "sequence": "MSKSLTLKNPGRVAYDSGGIKMFWEKKIEHHARHLQNEDIRVRRSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA", "length": 90, "header": "tr|A0A1B0GUP9-1|F240C_HUMAN Computationally mapped isoform of Protein FAM240C OS=Homo sapiens OX=9606 GN=FAM240C PE=1 SV=1 CANONICAL=A0A1B0GVR7-1" }, "locus": { "chromosome": "2", "start_pos": 241897331, "end_pos": 241894216, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000401641.2", "url": "https://www.ensembl.org/id/ENST00000401641.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000490196.1", "url": "https://www.ensembl.org/id/ENSP00000490196.1" } ] } }, { "isoform_ac": "A0A1B0GVR7-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVR7/entry#A0A1B0GVR7-1", "sequence": { "sequence": "MVGKNMSKSLTLKNPGRVAYDSGGIKMFWEKKIEHHARHLQNEDIRVRRSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA", "length": 95, "header": "sp|A0A1B0GVR7-1|F240C_HUMAN Isoform 1 of Protein FAM240C OS=Homo sapiens OX=9606 GN=FAM240C PE=1 SV=1 CANONICAL=A0A1B0GVR7-1" }, "locus": { "chromosome": "2", "start_pos": 241900369, "end_pos": 241894216, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000404031.6", "url": "https://www.ensembl.org/id/ENST00000404031.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000490626.1", "url": "https://www.ensembl.org/id/ENSP00000490626.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Initial sequencing and analysis of the human genome.", "journal": "Nature", "date": "2001", "authors": "Lander ES, Linton LM, Birren B, Nusbaum C, Zody MC, Baldwin J, Devon K, Dewar K, Doyle M, FitzHugh W, Funke R, Gage D, Harris K, Heaford A, Howland J, Kann L, Lehoczky J, LeVine R, McEwan P, McKernan K, Meldrim J, Mesirov JP, Miranda C, Morris W, Naylor J, Raymond C, Rosetti M, Santos R, Sheridan A, Sougnez C, Stange-Thomann Y, Stojanovic N, Subramanian A, Wyman D, Rogers J, Sulston J, Ainscough R, Beck S, Bentley D, Burton J, Clee C, Carter N, Coulson A, Deadman R, Deloukas P, Dunham A, Dunham I, Durbin R, French L, Grafham D, Gregory S, Hubbard T, Humphray S, Hunt A, Jones M, Lloyd C, McMurray A, Matthews L, Mercer S, Milne S, Mullikin JC, Mungall A, Plumb R, Ross M, Shownkeen R, Sims S, Waterston RH, Wilson RK, Hillier LW, McPherson JD, Marra MA, Mardis ER, Fulton LA, Chinwalla AT, Pepin KH, Gish WR, Chissoe SL, Wendl MC, Delehaunty KD, Miner TL, Delehaunty A, Kramer JB, Cook LL, Fulton RS, Johnson DL, Minx PJ, Clifton SW, Hawkins T, Branscomb E, Predki P, Richardson P, Wenning S, Slezak T, Doggett N, Cheng JF, Olsen A, Lucas S, Elkin C, Uberbacher E, Frazier M, Gibbs RA, Muzny DM, Scherer SE, Bouck JB, Sodergren EJ, Worley KC, Rives CM, Gorrell JH, Metzker ML, Naylor SL, Kucherlapati RS, Nelson DL, Weinstock GM, Sakaki Y, Fujiyama A, Hattori M, Yada T, Toyoda A, Itoh T, Kawagoe C, Watanabe H, Totoki Y, Taylor T, Weissenbach J, Heilig R, Saurin W, Artiguenave F, Brottier P, Bruls T, Pelletier E, Robert C, Wincker P, Smith DR, Doucette-Stamm L, Rubenfield M, Weinstock K, Lee HM, Dubois J, Rosenthal A, Platzer M, Nyakatura G, Taudien S, Rump A, Yang H, Yu J, Wang J, Huang G, Gu J, Hood L, Rowen L, Madan A, Qin S, Davis RW, Federspiel NA, Abola AP, Proctor MJ, Myers RM, Schmutz J, Dickson M, Grimwood J, Cox DR, Olson MV, Kaul R, Raymond C, Shimizu N, Kawasaki K, Minoshima S, Evans GA, Athanasiou M, Schultz R, Roe BA, Chen F, Pan H, Ramser J, Lehrach H, Reinhardt R, McCombie WR, de la Bastide M, Dedhia N, Blocker H, Hornischer K, Nordsiek G, Agarwala R, Aravind L, Bailey JA, Bateman A, Batzoglou S, Birney E, Bork P, Brown DG, Burge CB, Cerutti L, Chen HC, Church D, Clamp M, Copley RR, Doerks T, Eddy SR, Eichler EE, Furey TS, Galagan J, Gilbert JG, Harmon C, Hayashizaki Y, Haussler D, Hermjakob H, Hokamp K, Jang W, Johnson LS, Jones TA, Kasif S, Kaspryzk A, Kennedy S, Kent WJ, Kitts P, Koonin EV, Korf I, Kulp D, Lancet D, Lowe TM, McLysaght A, Mikkelsen T, Moran JV, Mulder N, Pollara VJ, Ponting CP, Schuler G, Schultz J, Slater G, Smit AF, Stupka E, Szustakowki J, Thierry-Mieg D, Thierry-Mieg J, Wagner L, Wallis J, Wheeler R, Williams A, Wolf YI, Wolfe KH, Yang SP, Yeh RF, Collins F, Guyer MS, Peterson J, Felsenfeld A, Wetterstrand KA, Patrinos A, Morgan MJ, de Jong P, Catanese JJ, Osoegawa K, Shizuya H, Choi S, Chen YJ, Szustakowki J", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GUP9", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GUP9" } ], "reference": [ { "type": "PubMed", "id": "11237011", "url": "https://glygen.org/publication/PubMed/11237011" } ] } ], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1B0GVR7-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 95, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1B0GVR7-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A1B0GVR7" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }