{ "uniprot_canonical_ac": "A0A1B0GSZ0-1", "uniprot_ac": "A0A1B0GSZ0", "uniprot_id": "SPAR_MOUSE", "mass": { "chemical_mass": 8470.0, "monoisotopic_mass": 8470.0 }, "refseq": { "ac": "NP_001335037", "name": "small regulatory polypeptide of amino acid response", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037" }, "gene_names": [ { "name": "Spaar", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0", "id": "A0A1B0GSZ0" }, { "name": "5430416O09Rik; Spar", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037", "id": "NP_001335037" }, { "name": "Spaar", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037", "id": "NP_001335037" }, { "name": "Spar", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0", "id": "A0A1B0GSZ0" } ], "protein_names": [ { "name": "Small regulatory polypeptide of amino acid response", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0/entry#names_and_taxonomy", "id": "A0A1B0GSZ0" }, { "name": "small regulatory polypeptide of amino acid response", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037", "id": "NP_001335037" } ], "function": [ { "annotation": "Data provide a mechanism by which mTORC1 activation may be finely regulated in a tissue-specific manner in response to injury, and a paradigm by which lncRNAs encoding small polypeptides like SPAR can modulate general biological pathways and processes to facilitate tissue-specific requirements, consistent with their restricted and highly regulated expression profile", "evidence": [ { "database": "RefSeq", "id": "NP_001335037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037" }, { "database": "PubMed", "id": "28024296", "url": "https://glygen.org/publication/PubMed/28024296" } ] }, { "annotation": "Negative regulator of amino acid sensing and mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels and amino acids (By similarity). Negatively regulates mTORC1 activation by inhibiting recruitment of mTORC1 to lysosomes upon stimulation with amino acids: acts by promoting the formation of a tightly bound supercomplex composed of the lysosomal V-ATPase, Ragulator and Rag GTPases, preventing recruitment of mTORC1 (By similarity). Acts as a regulator of muscle regeneration following injury by regulating mTORC1 activation (PubMed:28024296).", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0#function" }, { "database": "PubMed", "id": "28024296", "url": "https://glygen.org/publication/PubMed/28024296" }, { "database": "UniProtKB", "id": "A0A1B0GVQ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVQ0#function" } ] }, { "annotation": "The Influence of the LINC00961/SPAAR Locus Loss on Murine Development, Myocardial Dynamics, and Cardiac Response to Myocardial Infarction. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001335037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037" }, { "database": "PubMed", "id": "33478078", "url": "https://glygen.org/publication/PubMed/33478078" } ] }, { "annotation": "The LINC00961 transcript and its encoded micropeptide, small regulatory polypeptide of amino acid response, regulate endothelial cell function.", "evidence": [ { "database": "RefSeq", "id": "NP_001335037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037" }, { "database": "PubMed", "id": "31990292", "url": "https://glygen.org/publication/PubMed/31990292" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Spaar", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0", "locus": { "chromosome": "4", "start_pos": 43759462, "end_pos": 43730034, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000028475", "url": "https://www.ensembl.org/id/ENSMUSG00000028475" } ] } } ], "crossref": [ { "id": "MGI:1918656", "url": "https://alliancegenome.org/gene/MGI:1918656", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GSZ0", "url": "https://alphafold.ebi.ac.uk/entry/A0A1B0GSZ0", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000028475", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028475", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "71406", "url": "https://www.ncbi.nlm.nih.gov/gene/71406", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR054161", "url": "https://www.ebi.ac.uk/interpro/entry/IPR054161", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:71406", "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:71406", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1918656", "url": "http://www.informatics.jax.org/marker/MGI:1918656", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CDSRTQD", "url": "https://omabrowser.org/oma/group/CDSRTQD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GSZ0", "url": "https://www.orthodb.org/?gene=A0A1B0GSZ0", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF22004", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF22004", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A1B0GSZ0", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:PR_A0A1B0GSZ0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001335037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GSZ0-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "METAVIGMVAVLFVITMAITCILCYFSYDSHTQDPERSSRRSFTVATFHQEASLFTGPALQSRPLPRPQNFWTVV", "length": 75, "header": "sp|A0A1B0GSZ0-1|SPAR_MOUSE Isoform 1 of Small regulatory polypeptide of amino acid response OS=Mus musculus OX=10090 GN=Spaar PE=1 SV=1 CANONICAL=A0A1B0GSZ0-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GSZ0-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0/entry#A0A1B0GSZ0-1", "sequence": { "sequence": "METAVIGMVAVLFVITMAITCILCYFSYDSHTQDPERSSRRSFTVATFHQEASLFTGPALQSRPLPRPQNFWTVV", "length": 75, "header": "sp|A0A1B0GSZ0-1|SPAR_MOUSE Isoform 1 of Small regulatory polypeptide of amino acid response OS=Mus musculus OX=10090 GN=Spaar PE=1 SV=1 CANONICAL=A0A1B0GSZ0-1" }, "locus": { "chromosome": "4", "start_pos": 43731189, "end_pos": 43730965, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000131248.2", "url": "https://www.ensembl.org/id/ENSMUST00000131248.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000148128.2", "url": "https://www.ensembl.org/id/ENSMUSP00000148128.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "mTORC1 and muscle regeneration are regulated by the LINC00961-encoded SPAR polypeptide.", "journal": "Nature", "date": "2017", "authors": "Matsumoto A, Pasut A, Matsumoto M, Yamashita R, Fung J, Monteleone E, Saghatelian A, Nakayama KI, Clohessy JG, Pandolfi PP", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0" }, { "database": "RefSeq", "id": "NP_001335037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037" } ], "reference": [ { "type": "PubMed", "id": "28024296", "url": "https://glygen.org/publication/PubMed/28024296" } ] }, { "title": "The LINC00961 transcript and its encoded micropeptide, small regulatory polypeptide of amino acid response, regulate endothelial cell function.", "journal": "Cardiovascular research", "date": "2020", "authors": "Spencer HL, Sanders R, Boulberdaa M, Meloni M, Cochrane A, Spiroski AM, Mountford J, Emanueli C, Caporali A, Brittan M, Rodor J, Baker AH", "evidence": [ { "database": "RefSeq", "id": "NP_001335037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037" } ], "reference": [ { "type": "PubMed", "id": "31990292", "url": "https://glygen.org/publication/PubMed/31990292" } ] }, { "title": "The Influence of the LINC00961/SPAAR Locus Loss on Murine Development, Myocardial Dynamics, and Cardiac Response to Myocardial Infarction.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Spiroski AM, Sanders R, Meloni M, McCracken IR, Thomson A, Brittan M, Gray GA, Baker AH", "evidence": [ { "database": "RefSeq", "id": "NP_001335037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037" } ], "reference": [ { "type": "PubMed", "id": "33478078", "url": "https://glygen.org/publication/PubMed/33478078" } ] } ], "pathway": [ { "id": "mmu:71406", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:71406", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A1B0GVQ0-1", "protein_name": "Small regulatory polypeptide of amino acid response", "gene_name": "SPAAR", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGAKAPRGPKVAQWAMETAVIGVVVVLFVVTVAITCVLCCFSCDSRAQDPQGGPGRSFTVATFRQEASLFTGPVRHAQPVPSAQDFWTFM", "length": 90 }, "evidence": [ { "id": "HGNC:27244", "url": "https://alliancegenome.org/gene/HGNC:27244#orthology", "database": "AGR" }, { "id": "MGI:1918656", "url": "https://alliancegenome.org/gene/MGI:1918656#orthology", "database": "AGR" }, { "id": "A0A1B0GSZ0", "url": "https://omabrowser.org/oma/group/A0A1B0GSZ0/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "A0A3Q1M4Q1-1", "protein_name": "Small regulatory polypeptide of amino acid response", "gene_name": "SPAAR", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "METAVIGVVAVLFVVTVAITCVLCCFSCDSRSQDPQGAPSPSFTVATFRKEASLFTGPDHNAQPVAGAWDFWTFM", "length": 75 }, "evidence": [ { "id": "A0A1B0GSZ0", "url": "https://omabrowser.org/oma/group/A0A1B0GSZ0/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0" } ], "pmid": "" }, { "name": "lysosomal proton-transporting V-type ATPase complex", "id": "GO:0046611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046611", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "cellular response to amino acid stimulus", "id": "GO:0071230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071230", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0" } ], "pmid": "" }, { "name": "regulation of skeletal muscle tissue regeneration", "id": "GO:0043416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043416", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0" } ], "pmid": "" }, { "name": "negative regulation of TORC1 signaling", "id": "GO:1904262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904262", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSZ0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1B0GSZ0-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 75, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1B0GSZ0-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A1B0GSZ0" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }