{ "uniprot_canonical_ac": "A0A1B0GSF6-1", "uniprot_ac": "A0A1B0GSF6", "uniprot_id": "A0A1B0GSF6_MOUSE", "mass": { "chemical_mass": 10831.0, "monoisotopic_mass": 10831.0 }, "refseq": { "ac": "NP_001365225", "name": "small integral membrane protein 32", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001365225" }, "gene_names": [ { "name": "Smim32", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSF6", "id": "A0A1B0GSF6" }, { "name": "Gm45623", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001365225", "id": "NP_001365225" }, { "name": "Gm45623", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSF6", "id": "A0A1B0GSF6" }, { "name": "Smim32", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001365225", "id": "NP_001365225" } ], "protein_names": [ { "name": "Small integral membrane protein 32", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSF6/entry#names_and_taxonomy", "id": "A0A1B0GSF6" }, { "name": "small integral membrane protein 32", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001365225", "id": "NP_001365225" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSF6", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSF6" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Smim32", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSF6", "locus": { "chromosome": "13", "start_pos": 56900184, "end_pos": 56901640, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000110086", "url": "https://www.ensembl.org/id/ENSMUSG00000110086" } ] } } ], "crossref": [ { "id": "MGI:5791459", "url": "https://alliancegenome.org/gene/MGI:5791459", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GSF6", "url": "https://alphafold.ebi.ac.uk/entry/A0A1B0GSF6", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000110086", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000110086", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "115488204", "url": "https://www.ncbi.nlm.nih.gov/gene/115488204", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "5791459", "url": "http://www.informatics.jax.org/marker/MGI:5791459", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "YMSTARA", "url": "https://omabrowser.org/oma/group/YMSTARA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GSF6", "url": "https://www.orthodb.org/?gene=A0A1B0GSF6", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "NP_001365225", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001365225", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1B0GSF6", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSF6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GSF6-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSF6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYGDVFNATSGPEAAGSAALAPGATVKAEGALPLELATARGVRDGSATKPDLPTYLLLFFLLLLSVALVVLFIGCQLRHSAFAALPHDRSLRDARAPWKTRPV", "length": 103, "header": "tr|A0A1B0GSF6-1|A0A1B0GSF6_MOUSE Isoform 1 of Small integral membrane protein 32 OS=Mus musculus OX=10090 GN=Smim32 PE=4 SV=1 CANONICAL=A0A1B0GSF6-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GSF6-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSF6/entry#A0A1B0GSF6-1", "sequence": { "sequence": "MYGDVFNATSGPEAAGSAALAPGATVKAEGALPLELATARGVRDGSATKPDLPTYLLLFFLLLLSVALVVLFIGCQLRHSAFAALPHDRSLRDARAPWKTRPV", "length": 103, "header": "tr|A0A1B0GSF6-1|A0A1B0GSF6_MOUSE Isoform 1 of Small integral membrane protein 32 OS=Mus musculus OX=10090 GN=Smim32 PE=4 SV=1 CANONICAL=A0A1B0GSF6-1" }, "locus": { "chromosome": "13", "start_pos": 56901104, "end_pos": 56900796, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000210744.2", "url": "https://www.ensembl.org/id/ENSMUST00000210744.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000147916.2", "url": "https://www.ensembl.org/id/ENSMUSP00000147916.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Modernizing reference genome assemblies.", "journal": "PLoS Biol.", "date": "2011", "authors": "Church Deanna M, Schneider Valerie A, Graves Tina, Auger Katherine, Cunningham Fiona, Bouk Nathan, Chen Hsiu-Chuan, Agarwala Richa, McLaren William M, Ritchie Graham R S, Albracht Derek, Kremitzki Milinn, Rock Susan, Kotkiewicz Holland, Kremitzki Colin, Wollam Aye, Trani Lee, Fulton Lucinda, Fulton Robert, Matthews Lucy, Whitehead Siobhan, Chow Will, Torrance James, Dunn Matthew, Harden Glenn, Threadgold Glen, Wood Jonathan, Collins Joanna, Heath Paul, Griffiths Guy, Pelan Sarah, Grafham Darren, Eichler Evan E, Weinstock George, Mardis Elaine R, Wilson Richard K, Howe Kerstin, Flicek Paul, Hubbard Tim", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSF6", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSF6" } ], "reference": [ { "type": "PubMed", "id": "21750661", "url": "https://glygen.org/publication/PubMed/21750661" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A1B0GUA5-1", "protein_name": "Small integral membrane protein 32", "gene_name": "SMIM32", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MYGDIFNATGGPEAAVGSALAPGATVKAEGALPLELATARGMRDGAATKPDLPTYLLLFFLLLLSVALVVLFIGCQLRHSAFAALPHDRSLRDARAPWKTRPV", "length": 103 }, "evidence": [ { "id": "HGNC:53640", "url": "https://alliancegenome.org/gene/HGNC:53640#orthology", "database": "AGR" }, { "id": "MGI:5791459", "url": "https://alliancegenome.org/gene/MGI:5791459#orthology", "database": "AGR" }, { "id": "A0A1B0GSF6", "url": "https://omabrowser.org/oma/group/A0A1B0GSF6/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "A0A286ZRY9-1", "protein_name": "Small integral membrane protein 32", "gene_name": "SMIM32", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MYGDVFNATGGPEAAVGGALALAATVKAEGALPLELATARGMRDGAAAKPDLPTYLLLFFLLLLSVALVVLFIGCQLRHSAFAAMPHDRSLRDARAPWKMRPV", "length": 103 }, "evidence": [ { "id": "A0A1B0GSF6", "url": "https://omabrowser.org/oma/group/A0A1B0GSF6/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A3Q1M0N1-1", "protein_name": "Small integral membrane protein 32", "gene_name": "SMIM32", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MYGDVFNTTGGPEAAVGGALALAATVKAEGALPLELATARGMRDGAAAKPDLPTYLLLFFLLLLSVALVILFIGCQLRHSAFAALPHDRSLRDARAPWKMRPV", "length": 103 }, "evidence": [ { "id": "A0A1B0GSF6", "url": "https://omabrowser.org/oma/group/A0A1B0GSF6/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "G3HJ01-1", "protein_name": "Small integral membrane protein 32", "gene_name": "Smim32", "tax_id": 10029, "organism": "Cricetulus griseus", "sequence": { "sequence": "MYGDVFNATSGPEAAGSGALAPGATVKAEGALPLELATARGVRDSSATKPDLPTYLLLFFLLLLSVALVVLFIGCQLRHSAFAALPHDRSLRDARAPWKTRPV", "length": 103 }, "evidence": [ { "id": "A0A1B0GSF6", "url": "https://omabrowser.org/oma/group/A0A1B0GSF6/", "database": "OMA" } ], "glygen_name": "Hamster", "common_name": "Chinese hamster" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSF6", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GSF6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 7, "end_pos": 9, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1B0GSF6-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 103, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1B0GSF6-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A1B0GSF6" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 7, "end_pos": 9 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }