{
    "uniprot_canonical_ac": "A0A182-1",
    "uniprot_ac": "A0A182",
    "uniprot_id": "A0A182_DANRE",
    "mass": {
        "chemical_mass": 51041.0,
        "monoisotopic_mass": 51041.0
    },
    "refseq": {
        "ac": "NP_001075951",
        "name": "growth hormone releasing hormone receptor, like precursor",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075951"
    },
    "gene_names": [
        {
            "name": "ghrhrl",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprotkb/A0A182",
            "id": "A0A182"
        },
        {
            "name": "GHRHR",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A0A182",
            "id": "A0A182"
        },
        {
            "name": "ghrhrl",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075951",
            "id": "NP_001075951"
        },
        {
            "name": "ghrhr",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075951",
            "id": "NP_001075951"
        },
        {
            "name": "ghrhr",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A0A182",
            "id": "A0A182"
        }
    ],
    "protein_names": [
        {
            "name": "Growth hormone-releasing hormone receptor",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprotkb/A0A182/entry#names_and_taxonomy",
            "id": "A0A182"
        },
        {
            "name": "Growth hormone-releasing factor receptor",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A0A182/entry#names_and_taxonomy",
            "id": "A0A182"
        },
        {
            "name": "growth hormone releasing hormone receptor, like precursor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075951",
            "id": "NP_001075951"
        },
        {
            "name": "growth hormone-releasing hormone receptor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075951",
            "id": "NP_001075951"
        }
    ],
    "function": [
        {
            "annotation": "##Evidence-Data-START## Transcript exon combination :: DQ991247.1 [ECO:0000332] RNAseq introns :: partial sample support SAMEA3505390, SAMEA4476746 [ECO:0000350] ##Evidence-Data-END## PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ991247.1. On Mar 11, 2007 this sequence version replaced XP_001333072.1.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001075951",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075951"
                }
            ]
        },
        {
            "annotation": "Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A182",
                    "url": "https://www.uniprot.org/uniprotkb/A0A182#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "ARBA00055347",
                    "url": "https://www.uniprot.org/uniprotkb/ARBA00055347#function"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0060870",
            "recommended_name": {
                "id": "DOID:0060870",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0060870",
                "name": "isolated growth hormone deficiency",
                "description": "A hypopituitarism characterized by abnormally low levels, absence or impaired function of growth hormone in the absence of abnormalities in other pituitary hormones."
            },
            "synonyms": [
                {
                    "id": "DOID:0060870",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060870",
                    "name": "IGHD",
                    "description": ""
                },
                {
                    "id": "DOID:0060870",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060870",
                    "name": "congenital IGHD",
                    "description": ""
                },
                {
                    "id": "DOID:0060870",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060870",
                    "name": "congenital isolated GH deficiency",
                    "description": ""
                },
                {
                    "id": "DOID:0060870",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060870",
                    "name": "congenital isolated growth hormone deficiency",
                    "description": ""
                },
                {
                    "id": "DOID:0060870",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060870",
                    "name": "familial isolated growth hormone deficiency",
                    "description": ""
                },
                {
                    "id": "DOID:0060870",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060870",
                    "name": "non-acquired isolated growth hormone deficiency",
                    "description": ""
                }
            ],
            "unlinked_id_list": [],
            "evidence": [
                {
                    "id": "0060870",
                    "database": "AGR",
                    "url": "https://www.alliancegenome.org/disease/DOID:0060870"
                }
            ]
        },
        {
            "disease_id": "DOID:0060874",
            "recommended_name": {
                "id": "DOID:0060874",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0060874",
                "name": "isolated growth hormone deficiency type IB",
                "description": "An isolated growth hormone deficiency characterized by autosomal recessive inheritance of low but detectable levels of GH, short stature, significantly retarded bone age, and a positive response and immunologic tolerance to growth hormone therapy that has_material_basis_in mutation in the GH1 or GHRHR genes on chromosomes 17q23.3 and 7p14.3, respectively."
            },
            "synonyms": [
                {
                    "id": "DOID:0060874",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060874",
                    "name": "IGHD IB",
                    "description": ""
                },
                {
                    "id": "DOID:0060874",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060874",
                    "name": "congenital IGHD type IB",
                    "description": ""
                },
                {
                    "id": "DOID:0060874",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060874",
                    "name": "congenital isolated GH deficiency type IB",
                    "description": ""
                },
                {
                    "id": "DOID:0060874",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060874",
                    "name": "dwarfism of Sindh",
                    "description": ""
                },
                {
                    "id": "DOID:0060874",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060874",
                    "name": "congenital isolated growth hormone deficiency type IB",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "isolated growth hormone deficiency type IB",
                    "description": "An isolated growth hormone deficiency characterized by autosomal recessive inheritance of low but detectable levels of GH, short stature, significantly retarded bone age, and a positive response and immunologic tolerance to growth hormone therapy that has material basis in mutation in the GH1 or GHRHR genes on chromosomes 17q23.3 and 7p14.3, respectively."
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "IGHD IB",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "congenital IGHD type IB",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "congenital isolated GH deficiency type IB",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "congenital isolated growth hormone deficiency type IB",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "dwarfism of Sindh",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "growth hormone deficiency, isolated, type IB",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "IGHD 1B",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "IGHD1B",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "isolated Growth hormone deficiency, type 1B",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "isolated growth hormone deficiency type 1B",
                    "description": ""
                },
                {
                    "id": "MONDO:0013006",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013006",
                    "name": "isolated growth hormone deficiency, type IB",
                    "description": ""
                },
                {
                    "id": "MONDO:0032567",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0032567",
                    "name": "isolated growth hormone deficiency, type 4",
                    "description": ""
                },
                {
                    "id": "MONDO:0032567",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0032567",
                    "name": "growth hormone deficiency, isolated, type IV",
                    "description": ""
                },
                {
                    "id": "MONDO:0032567",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0032567",
                    "name": "Dwarfism of Sindh",
                    "description": ""
                },
                {
                    "id": "MONDO:0032567",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0032567",
                    "name": "IGHD4",
                    "description": ""
                },
                {
                    "id": "MONDO:0032567",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0032567",
                    "name": "ISOLATED GROWTH HORMONE DEFICIENCY, TYPE IV",
                    "description": ""
                },
                {
                    "id": "MONDO:0032567",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0032567",
                    "name": "Isolated Growth Hormone Deficiency, Type Ib",
                    "description": ""
                },
                {
                    "id": "MONDO:0032567",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0032567",
                    "name": "Isolated Growth Hormone Deficiency, Type Ib, Formerly",
                    "description": ""
                },
                {
                    "id": "MIM:612781",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/612781",
                    "name": "Growth hormone deficiency, isolated, 1B",
                    "description": "Growth hormone deficiency, isolated, 1B"
                },
                {
                    "id": "MIM:618157",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/618157",
                    "name": "Growth hormone deficiency, isolated, 4",
                    "description": "Growth hormone deficiency, isolated, 4"
                }
            ],
            "unlinked_id_list": [],
            "evidence": [
                {
                    "id": "0060874",
                    "database": "AGR",
                    "url": "https://www.alliancegenome.org/disease/DOID:0060874"
                }
            ]
        },
        {
            "disease_id": "DOID:535",
            "recommended_name": {
                "id": "DOID:535",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:535",
                "name": "sleep disorder",
                "description": "A disease of mental health that involves disruption of sleep patterns."
            },
            "synonyms": [
                {
                    "id": "DOID:535",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:535",
                    "name": "Non-organic sleep disorder",
                    "description": ""
                }
            ],
            "unlinked_id_list": [],
            "evidence": [
                {
                    "id": "535",
                    "database": "AGR",
                    "url": "https://www.alliancegenome.org/disease/DOID:535"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Danio rerio",
            "taxid": 7955,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A182",
                    "url": "https://www.uniprot.org/uniprotkb/A0A182"
                }
            ],
            "common_name": "Zebrafish",
            "glygen_name": "Zebrafish",
            "reference_species": "Danio rerio [7955]"
        }
    ],
    "gene": [
        {
            "name": "ghrhrl",
            "url": "https://www.uniprot.org/uniprotkb/A0A182",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "ZFIN:ZDB-GENE-090211-1",
            "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-090211-1",
            "database": "AGR",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd15270",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15270",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "793334",
            "url": "https://www.ncbi.nlm.nih.gov/gene/793334",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000832",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000832",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001771",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001771",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001879",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001879",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017981",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017981",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017983",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017983",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036445",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036445",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR050332",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR050332",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "dre:793334",
            "url": "https://www.genome.jp/dbget-bin/www_bget?dre:793334",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "A0A182",
            "url": "https://www.orthodb.org/?gene=A0A182",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR45620",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45620",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR45620:SF14",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45620:SF14",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00002",
            "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00002",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF02793",
            "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02793",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DRE-420092",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DRE-420092",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001075951",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075951",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A182",
            "url": "https://www.uniprot.org/uniprotkb/A0A182",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A182-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A182-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "ZDB-GENE-090211-1",
            "url": "https://zfin.org/ZDB-GENE-090211-1",
            "database": "ZFIN",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        }
    ],
    "sequence": {
        "sequence": "MLPCARGLFWLLTCLTTVLCSLHPECEYIFQLARDEQRCLREITDLGNLSSSSGCLSVWDSVVCWPSAVVGETVQSPCPAVFSLFENNTEGVVSRNCTVTGWSRPFPPYHVACSAEDNIPEESYFATVKLIYTVGYGASLLSLSVAVLILLLFRRLHCTRNYIHMQLFFTFILKSVAVFIKDVTLFSSDDTDHCSLSTVACKTAVVFCHYCVMSNFFWLLVEAVYLNSLLVSVFLRRRRCLWAFALLGWGVPLVCIVLWIFSRLYFEDTECWDINEDSPYWWIIKGPIVISIAVNFLLFLNIIRILMQKLNPRLIQFNNSDQYRRLTKSTLLLIPLFGTHYMIFSFLPDYFNTGLRLCIELCLGSFQGLIVAILYCFLNQEVQNEIRLRWLRYQEGSYAVVPVGVKGSQMDTPVHRQTRRNSIKHFTVCILFCSFYMTTIGLKGT",
        "length": 445,
        "header": "tr|A0A182-1|A0A182_DANRE Isoform 1 of Growth hormone-releasing hormone receptor  OS=Danio rerio OX=7955 GN=ghrhrl PE=2 SV=1 CANONICAL=A0A182-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A182-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A182/entry#A0A182-1",
            "sequence": {
                "sequence": "MLPCARGLFWLLTCLTTVLCSLHPECEYIFQLARDEQRCLREITDLGNLSSSSGCLSVWDSVVCWPSAVVGETVQSPCPAVFSLFENNTEGVVSRNCTVTGWSRPFPPYHVACSAEDNIPEESYFATVKLIYTVGYGASLLSLSVAVLILLLFRRLHCTRNYIHMQLFFTFILKSVAVFIKDVTLFSSDDTDHCSLSTVACKTAVVFCHYCVMSNFFWLLVEAVYLNSLLVSVFLRRRRCLWAFALLGWGVPLVCIVLWIFSRLYFEDTECWDINEDSPYWWIIKGPIVISIAVNFLLFLNIIRILMQKLNPRLIQFNNSDQYRRLTKSTLLLIPLFGTHYMIFSFLPDYFNTGLRLCIELCLGSFQGLIVAILYCFLNQEVQNEIRLRWLRYQEGSYAVVPVGVKGSQMDTPVHRQTRRNSIKHFTVCILFCSFYMTTIGLKGT",
                "length": 445,
                "header": "tr|A0A182-1|A0A182_DANRE Isoform 1 of Growth hormone-releasing hormone receptor  OS=Danio rerio OX=7955 GN=ghrhrl PE=2 SV=1 CANONICAL=A0A182-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Discovery of growth hormone-releasing hormones and receptors in nonmammalian vertebrates.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2007",
            "authors": "Lee Leo T O, Siu Francis K Y, Tam Janice K V, Lau Ivy T Y, Wong Anderson O L, Lin Marie C M, Vaudry Hubert, Chow Billy K C",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A182",
                    "url": "https://www.uniprot.org/uniprotkb/A0A182"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17283332",
                    "url": "https://glygen.org/publication/PubMed/17283332"
                }
            ]
        },
        {
            "title": "Newly-identified receptors for peptide histidine-isoleucine and GHRH-like peptide in zebrafish help to elucidate the mammalian secretin superfamily.",
            "journal": "J. Mol. Endocrinol.",
            "date": "2008",
            "authors": "Wu Sheng, Roch Graeme J, Cervini Laura A, Rivier Jean E, Sherwood Nancy M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A182",
                    "url": "https://www.uniprot.org/uniprotkb/A0A182"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18757498",
                    "url": "https://glygen.org/publication/PubMed/18757498"
                }
            ]
        },
        {
            "title": "Structural and functional divergence of growth hormone-releasing hormone receptors in early sarcopterygians: lungfish and Xenopus.",
            "journal": "PLoS ONE",
            "date": "2013",
            "authors": "Tam Janice K V, Chow Billy K C, Lee Leo T O",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A182",
                    "url": "https://www.uniprot.org/uniprotkb/A0A182"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23308232",
                    "url": "https://glygen.org/publication/PubMed/23308232"
                }
            ]
        },
        {
            "title": "The zebrafish reference genome sequence and its relationship to the human genome.",
            "journal": "Nature",
            "date": "2013",
            "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James  D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A182",
                    "url": "https://www.uniprot.org/uniprotkb/A0A182"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23594743",
                    "url": "https://glygen.org/publication/PubMed/23594743"
                }
            ]
        },
        {
            "title": "Functional Pairing of Class B1 Ligand-GPCR in Cephalochordate Provides Evidence of the Origin of PTH and PACAP/Glucagon Receptor Family.",
            "journal": "Mol. Biol. Evol.",
            "date": "2015",
            "authors": "On Jason S W, Duan Cumming, Chow Billy K C, Lee Leo T O",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A182",
                    "url": "https://www.uniprot.org/uniprotkb/A0A182"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25841489",
                    "url": "https://glygen.org/publication/PubMed/25841489"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "dre:793334",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/www_bget?dre:793334",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-DRE-420092",
            "name": "",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DRE-420092",
            "resource": "Reactome",
            "description": "Glucagon-type ligand receptors"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "A0AB32TTN3-1",
            "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor isoform X1",
            "gene_name": "ghrhrb",
            "tax_id": 7955,
            "organism": "Danio rerio",
            "sequence": {
                "sequence": "MGLFLRPACSQQEGPIDQPPARGLSHRQNHRPFGIYAEDLLEAVRGLGFSETTLIHIFLAGLDEPFDWEELGDIRTWTFWEVVDYSCLRMEREILEGEWTPLTTSTISWSMSSPQGLTRTQKRRRKRKASSARVAPAPERPPVSAPAPERPPFVITFRRLKSSPVVFPVLILSSLPSPVWCPTEWDEFWCWSGAEVGQVVNISCSEVSQLFVNHGFIFRNCTKDGWTEVYPSYENACEIVEDVESETETTYYATFRQVYTAGYATSLISLITAIFVFTVFRKFHCTRNYIHINLFASFILRASAIFIKDAVLFADENLDHCFMSTTSCKAAVAFFQFSILANYFWLLVEGMYLQTLLALTFVSQKKYFWWYILIGWGLPTLILTIWVLARNFFDNNGCWDDTDVAYFWWIIKGPITVSLLINFLIFINVIRILVQKLKSPGMGGGDTNHFMRLAKSTLFLIPLFGMHYMVFAFLPENTGENARHFLELGLGPFQGFVVALLYCFLNGEVQAELKKRLWKWQTQSYLRYSKRRRTLFTESSTVTQISVLEKSSPKELPLTESNNSVSTV",
                "length": 568
            },
            "evidence": [
                {
                    "id": "MGI:95710",
                    "url": "https://alliancegenome.org/gene/MGI:95710#orthology",
                    "database": "AGR"
                },
                {
                    "id": "HGNC:4266",
                    "url": "https://alliancegenome.org/gene/HGNC:4266#orthology",
                    "database": "AGR"
                }
            ],
            "glygen_name": "Zebrafish",
            "common_name": "Zebrafish"
        },
        {
            "uniprot_canonical_ac": "B4XV21-1",
            "protein_name": "Growth hormone releasing hormone receptor a precursor",
            "gene_name": "ghrhra",
            "tax_id": 7955,
            "organism": "Danio rerio",
            "sequence": {
                "sequence": "MTVVHLCLFAGFWRAMHAIHPDCAIISQLIQDQETCIQTRKREIKNHSQQTGCGTDWDGIRCWHTANTGQLINVSCSDVFQHISNTQGFIYRNCVSNGWTDPYPPYEEACAFEDDSESGTVTTYLSTLKQLYTAGYATSLISLITAVIIFTCFRKFHCTRNYIHINLFVSFILRASAVFIKGTVLFSDETQDHCLMSTVLCKSAVTFFQFCILTNYFWLLVEGLYLQTLLALTFVSQRKYFWWYILIGWGVPSVVLVVWVLTRQFYDNRGCWDDTDNTNIWWIIKGPITASLFTNIIIFLNVIRILVQKLKSPGVGGNDTGHFMRLAKSTLFLIPLFGMHYTLFAFLPENTGEIIRFYIELGLGSFQGFVVALLYCFLNGEVQAELKRRLWTWLTQTHLSPCKKRRVTVTQIMMHESAHPHSDVCNGHITAV",
                "length": 432
            },
            "evidence": [
                {
                    "id": "MGI:95710",
                    "url": "https://alliancegenome.org/gene/MGI:95710#orthology",
                    "database": "AGR"
                },
                {
                    "id": "HGNC:4266",
                    "url": "https://alliancegenome.org/gene/HGNC:4266#orthology",
                    "database": "AGR"
                }
            ],
            "glygen_name": "Zebrafish",
            "common_name": "Zebrafish"
        },
        {
            "uniprot_canonical_ac": "P32082-1",
            "protein_name": "Growth hormone-releasing hormone receptor",
            "gene_name": "Ghrhr",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MDGLMWATRILCLLSLCGVTLGHLHLECDFITQLRDDELACLQAAEGTNNTSLGCPGTWDGLLCWPPTGSGQWVSLPCPEFFSHFGSDTGFVKRDCTITGWSNPFPPYPVACPVPLELLTKEKSYFSTVKIIYTTGHSISIVALCVAIAILVALRRLHCPRNYIHTQLFATFILKASAVFLKDAAIFQGDSTDHCSMSTVLCKVSVAISHLATMTNFSWLLAEAVYLSCLLASTSPRSKPAFWWLVLAGWGLPVLCTGTWVGCKLAFEDTECWDLDNSSPCWWIIKGPIVLSVGVNFGLFLNIICILLRKLEPAQGGLHTRAQYWRLSKSTLLLIPLFGIHYIIFNFLPDSAGLDIRVPLELGLGSFQGFIVAVLYCFLNQEVRTEISRKWYGHDPELLPARRTCTEWTTPPRSRLKVLTSEC",
                "length": 423
            },
            "evidence": [
                {
                    "id": "ZFIN:ZDB-GENE-090211-1",
                    "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-090211-1#orthology",
                    "database": "AGR"
                },
                {
                    "id": "RGD:2688",
                    "url": "https://alliancegenome.org/gene/RGD:2688#orthology",
                    "database": "AGR"
                },
                {
                    "id": "MGI:95710",
                    "url": "https://alliancegenome.org/gene/MGI:95710#orthology",
                    "database": "AGR"
                },
                {
                    "id": "HGNC:4266",
                    "url": "https://alliancegenome.org/gene/HGNC:4266#orthology",
                    "database": "AGR"
                }
            ],
            "glygen_name": "Mouse",
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q02643-1",
            "protein_name": "Growth hormone-releasing hormone receptor",
            "gene_name": "GHRHR",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVFLKDAALFHSDDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLNCLLASTSPSSRRAFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPLELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLTSMC",
                "length": 423
            },
            "evidence": [
                {
                    "id": "ZFIN:ZDB-GENE-090211-1",
                    "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-090211-1#orthology",
                    "database": "AGR"
                },
                {
                    "id": "RGD:2688",
                    "url": "https://alliancegenome.org/gene/RGD:2688#orthology",
                    "database": "AGR"
                },
                {
                    "id": "MGI:95710",
                    "url": "https://alliancegenome.org/gene/MGI:95710#orthology",
                    "database": "AGR"
                },
                {
                    "id": "HGNC:4266",
                    "url": "https://alliancegenome.org/gene/HGNC:4266#orthology",
                    "database": "AGR"
                }
            ],
            "glygen_name": "Human",
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q02644-1",
            "protein_name": "Growth hormone-releasing hormone receptor",
            "gene_name": "Ghrhr",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MDSLLWATWVLCLLNLWGVALGHLHLECDFITQLRDDELACLQAAEGTNNSSMGCPGTWDGLLCWPPTGSGQWVSLPCPEFFSHFGSDPGAVKRDCTITGWSDPFPPYPVACPVPLELLTEEKSYFSTVKIIYTTGHSISIVALCVAIAILVALRRLHCPRNYIHTQLFATFILKASAVFLKDAAVFQGDSTDHCSMSTILCKVSVAVSHFATMTNFSWLLAEAVYLSCLLASTSPRSKPAFWWLVLAGWGLPVLCTGTWVGCKLAFEDTACWDLDDSSPYWWIIKGPIVLSVGVNFGLFLNIICILLRKLGPAQGGLHTRAQYCNYLLPWSCPLPQVPRERTDLGPSSHEITVQESGTRNCQLPWRLSKSTLLLIPLFGIHYIIFNFLPDSAGLGIRLPLELGLGSFQGFVVAVLYCFLNQEVRTEISRKWYGHDPELLPARRTCTEWTTPPRSRVKVLTSEC",
                "length": 464
            },
            "evidence": [
                {
                    "id": "ZFIN:ZDB-GENE-090211-1",
                    "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-090211-1#orthology",
                    "database": "AGR"
                },
                {
                    "id": "RGD:2688",
                    "url": "https://alliancegenome.org/gene/RGD:2688#orthology",
                    "database": "AGR"
                },
                {
                    "id": "MGI:95710",
                    "url": "https://alliancegenome.org/gene/MGI:95710#orthology",
                    "database": "AGR"
                },
                {
                    "id": "HGNC:4266",
                    "url": "https://alliancegenome.org/gene/HGNC:4266#orthology",
                    "database": "AGR"
                }
            ],
            "glygen_name": "Rat",
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A182",
                                "url": "https://www.uniprot.org/uniprotkb/A0A182"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "cell surface receptor signaling pathway",
                        "id": "GO:0007166",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A182",
                                "url": "https://www.uniprot.org/uniprotkb/A0A182"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "adenylate cyclase-activating G protein-coupled receptor signaling pathway",
                        "id": "GO:0007189",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007189",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A182",
                                "url": "https://www.uniprot.org/uniprotkb/A0A182"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cell population proliferation",
                        "id": "GO:0008284",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A182",
                                "url": "https://www.uniprot.org/uniprotkb/A0A182"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 5,
                "go_terms": [
                    {
                        "name": "growth factor binding",
                        "id": "GO:0019838",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019838",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A182",
                                "url": "https://www.uniprot.org/uniprotkb/A0A182"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "peptide hormone binding",
                        "id": "GO:0017046",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017046",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A182",
                                "url": "https://www.uniprot.org/uniprotkb/A0A182"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "G protein-coupled peptide receptor activity",
                        "id": "GO:0008528",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008528",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A182",
                                "url": "https://www.uniprot.org/uniprotkb/A0A182"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "growth hormone-releasing hormone receptor activity",
                        "id": "GO:0016520",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016520",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A182",
                                "url": "https://www.uniprot.org/uniprotkb/A0A182"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "vasoactive intestinal polypeptide receptor activity",
                        "id": "GO:0004999",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004999",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A182",
                                "url": "https://www.uniprot.org/uniprotkb/A0A182"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 318,
            "end_pos": 320,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 48,
            "end_pos": 50,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 87,
            "end_pos": 89,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 96,
            "end_pos": 98,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "structures": [],
    "synthesized_glycans": [],
    "enzyme_annotation": [],
    "cluster_types": [
        {
            "name": "homologset.agr",
            "label": "AGR Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 318,
                "end_pos": 320
            },
            {
                "start_pos": 48,
                "end_pos": 50
            },
            {
                "start_pos": 87,
                "end_pos": 89
            },
            {
                "start_pos": 96,
                "end_pos": 98
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 5
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}