{ "uniprot_canonical_ac": "A0A181-1", "uniprot_ac": "A0A181", "uniprot_id": "A0A181_DANRE", "mass": { "chemical_mass": 12678.0, "monoisotopic_mass": 12678.0 }, "refseq": { "ac": "NP_001073561", "name": "somatoliberin precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073561" }, "gene_names": [ { "name": "ghrh", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A181", "id": "A0A181" }, { "name": "GHRH", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A181", "id": "A0A181" }, { "name": "ghrh", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073561", "id": "NP_001073561" } ], "protein_names": [ { "name": "Somatoliberin", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A181/entry#names_and_taxonomy", "id": "A0A181" }, { "name": "Growth hormone-releasing factor", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A181/entry#names_and_taxonomy", "id": "A0A181" }, { "name": "Growth hormone-releasing hormone", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A181/entry#names_and_taxonomy", "id": "A0A181" }, { "name": "somatoliberin precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073561", "id": "NP_001073561" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: DQ832172.1, DQ991246.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA3505377, SAMEA3505381 [ECO:0006172] ##Evidence-Data-END## PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ832172.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.", "evidence": [ { "database": "RefSeq", "id": "NP_001073561", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073561" } ] }, { "annotation": "GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181#function" }, { "database": "UniProtKB", "id": "ARBA00037623", "url": "https://www.uniprot.org/uniprotkb/ARBA00037623#function" } ] } ], "disease": [ { "disease_id": "DOID:0050167", "recommended_name": { "id": "DOID:0050167", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050167", "name": "autoimmune polyendocrine syndrome type 1", "description": "An autoimmune polyendocrine syndrome that is inherited in an autosomal recessive fashion, which is characterized by abnormal functioning of the immune system that causes auto-reactivity against endocrine organs." }, "synonyms": [ { "id": "DOID:0050167", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050167", "name": "Autoimmune Polyglandular Syndrome I", "description": "" }, { "id": "DOID:0050167", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050167", "name": "Whitaker syndrome", "description": "" }, { "id": "DOID:0050167", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050167", "name": "autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrine syndrome type 1", "description": "Autoimmune polyendocrinopathy type 1, or APECED syndrome, is a genetic disease that manifests in childhood or early adolescence with a combination of chronic mucocutaneous candidiasis, hypoparathyroidism and autoimmune adrenal failure." }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "AIRE autoimmune polyendocrinopathy", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "APECED syndrome", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "APS type 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "APS1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "Autoimmune Polyglandular Syndrome Type 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "MEDAC syndrome", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "Whitaker syndrom", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "aire autoimmune polyendocrinopathy", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune hypoparathyroidism-chronic candidiasis-Addison disease syndrome", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrine syndrome type 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrinopathy caused by mutation in AIRE", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrinopathy caused by mutation in aire", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrinopathy syndrome , type I, with or without reversible metaphyseal dysplasia", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy syndrome", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyglandular syndrome I", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyglandular syndrome type 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "ham syndrome", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "hypoparathyroidism-Addison disease-mucocutaneous candidiasis syndrome", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "multiple endocrine deficiency-Addison disease-candidiasis syndrome", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "polyglandular autoimmune syndrome type 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "APS 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "PGA 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "Whitaker syndrome", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrine syndrome, type I, with or without reversible metaphyseal dysplasia", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrinopathy syndrome type 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrinopathy syndrome, type I, autosomal dominant", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrinopathy type 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED)", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "autoimmune polyglandular syndrome, type 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "hypoadrenocorticism with hypoparathyroidism and superficial Moniliasis", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "polyglandular autoimmune syndrome, type 1", "description": "" }, { "id": "MONDO:0009411", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009411", "name": "polyglandular deficiency syndrome, Persian-Jewish type", "description": "" }, { "id": "MIM:240300", "resource": "MIM", "url": "https://www.omim.org/entry/240300", "name": "Autoimmune polyendocrine syndrome 1, with or without reversible metaphyseal dysplasia", "description": "Autoimmune polyendocrine syndrome 1, with or without reversible metaphyseal dysplasia" } ], "unlinked_id_list": [], "evidence": [ { "id": "0050167", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050167" } ] }, { "disease_id": "DOID:0050848", "recommended_name": { "id": "DOID:0050848", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050848", "name": "obstructive sleep apnea", "description": "A sleep apnea that is characterized by repeated collapse and obstruction of the upper airway during sleep, which results in reduced airflow (hypopnea) or complete airflow cessation (apnea), oxygen desaturation, and arousals from sleep." }, "synonyms": [ { "id": "DOID:0050848", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050848", "name": "obstructive sleep apnea syndrome", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "obstructive sleep apnea syndrome", "description": "Cessation of air flow during sleep due to upper airway obstruction." }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "obstructive sleep apnea", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "obstructive sleep apnea syndrome", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "Apneas, obstructive sleep", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "OSAHS", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "Osa", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "apnea, obstructive sleep", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "obstructive sleep Apneas", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "sleep Apneas, obstructive", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "sleep apnea hypopnea syndrome", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "sleep apnea syndrome, obstructive", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "sleep apnea/hypopnea syndrome", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "syndrome, obstructive sleep apnea", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "syndrome, sleep apnea, obstructive", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "syndrome, upper airway resistance, sleep apnea", "description": "" }, { "id": "MONDO:0007147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007147", "name": "upper airway resistance sleep apnea syndrome", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "0050848", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050848" } ] }, { "disease_id": "DOID:0060873", "recommended_name": { "id": "DOID:0060873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060873", "name": "isolated growth hormone deficiency type IA", "description": "An isolated growth hormone deficiency characterized by autosomal recessive inheritance of severe dwarfism with onset by 6 months of age and variable development of antibodies to growth hormone following exogenous supplementation that has_material_basis_in null mutations in the GH1 gene on chromosome 17q23.3." }, "synonyms": [ { "id": "DOID:0060873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060873", "name": "IGHD IA", "description": "" }, { "id": "DOID:0060873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060873", "name": "Illig-type growth hormone deficiency", "description": "" }, { "id": "DOID:0060873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060873", "name": "pituitary dwarfism I", "description": "" }, { "id": "DOID:0060873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060873", "name": "primordial dwarfism", "description": "" }, { "id": "DOID:0060873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060873", "name": "sexual ateleiotic dwarfism", "description": "" }, { "id": "DOID:0060873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060873", "name": "autosomal recessive isolated growth hormone deficiency", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "isolated growth hormone deficiency type IA", "description": "An isolated growth hormone deficiency characterized by autosomal recessive inheritance of severe dwarfism with onset by 6 months of age and variable development of antibodies to growth hormone following exogenous supplementation that has material basis in null mutations in the GH1 gene on chromosome 17q23.3." }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "IGHD IA", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "Illig-type growth hormone deficiency", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "autosomal recessive isolated growth hormone deficiency", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "congenital IGHD type IA", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "congenital isolated GH deficiency type IA", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "congenital isolated growth hormone deficiency type IA", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "growth hormone deficiency, isolated, type IA", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "isolated growth hormone deficiency type IA", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "pituitary dwarfism I", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "primordial dwarfism", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "sexual ateleiotic dwarfism", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "Growth hormone deficiency, isolated autosomal recessive", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "Growth hormone deficiency, isolated, autosomal recessive", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "IGHD 1A", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "IGHD1A", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "ILLIG type growth hormone deficiency", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "Illig-type Growth hormone deficiency", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "congenital IGHD", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "congenital isolated GH deficiency", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "congenital isolated growth hormone deficiency", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "isolated Growth hormone deficiency, type 1A", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "isolated growth hormone deficiency type 1A", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "isolated growth hormone deficiency, type IA", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "non-acquired isolated growth hormone deficiency", "description": "" }, { "id": "MONDO:0009876", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009876", "name": "pituitary dwarfism 1", "description": "" }, { "id": "MIM:262400", "resource": "MIM", "url": "https://www.omim.org/entry/262400", "name": "Growth hormone deficiency, isolated, 1A", "description": "Growth hormone deficiency, isolated, 1A" } ], "unlinked_id_list": [], "evidence": [ { "id": "0060873", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060873" } ] }, { "disease_id": "DOID:10286", "recommended_name": { "id": "DOID:10286", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10286", "name": "prostate carcinoma", "description": "A prostate cancer that has_material_basis_in abnormally proliferating cells derives_from epithelial cells." }, "synonyms": [ { "id": "DOID:10286", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10286", "name": "cancer of prostate", "description": "" }, { "id": "DOID:10286", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10286", "name": "carcinoma of prostate", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "10286", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10286" } ] }, { "disease_id": "DOID:11132", "recommended_name": { "id": "DOID:11132", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11132", "name": "prostatic hypertrophy", "description": "" }, "synonyms": [ { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic hyperplasia", "description": "A non-cancerous nodular enlargement of the prostate gland. It is characterized by the presence of epithelial cell nodules, and stromal nodules containing fibrous and smooth muscle elements. It is the most common urologic disorder in men, causing blockage of urine flow." }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "prostate hypertrophy", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "prostatic hypertrophy", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign hyperplasia of prostate", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign hyperplasia of the prostate", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostate hyperplasia", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic Hypertrophy", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic hyperplasia", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic hyperplasia (disease)", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic hyperplasia - BPH", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "benign prostatic hypertrophy", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "BPH", "description": "" }, { "id": "MONDO:0010811", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010811", "name": "prostatic hyperplasia, benign", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "11132", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11132" } ] }, { "disease_id": "DOID:1380", "recommended_name": { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "endometrial cancer", "description": "A uterine cancer that is located_in tissues lining the uterus." }, "synonyms": [ { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "endometrial Ca", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "endometrial neoplasm", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "malignant endometrial neoplasm", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "malignant neoplasm of endometrium", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "neoplasm of endometrium", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "primary malignant neoplasm of endometrium", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "tumor of Endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial cancer", "description": "Primary or metastatic malignant neoplasm involving the endometrium (mucous membrane that lines the endometrial cavity)." }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial neoplasm", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "neoplasm of endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "tumor of endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "tumour of endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "cancer of endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial Ca", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial cancer", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial cancer, familial, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial carcinoma, somatic", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrium cancer", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "malignant endometrial neoplasm", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "malignant endometrium neoplasm", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "malignant neoplasm of endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "primary malignant neoplasm of endometrium", "description": "" }, { "id": "MIM:608089", "resource": "MIM", "url": "https://www.omim.org/entry/608089", "name": "Endometrial cancer", "description": "Endometrial cancer" } ], "unlinked_id_list": [ "DOID:5166" ], "evidence": [ { "id": "1380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1380" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ], "unlinked_id_list": [ "DOID:0050938", "DOID:3017" ], "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] }, { "disease_id": "DOID:2394", "recommended_name": { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." }, "synonyms": [ { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "tumor of the Ovary", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "OVCAS1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas." }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, somatic", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, epithelial", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "primary ovarian cancer", "description": "" }, { "id": "MIM:167000", "resource": "MIM", "url": "https://www.omim.org/entry/167000", "name": "Ovarian cancer", "description": "Ovarian cancer" } ], "unlinked_id_list": [ "DOID:2151" ], "evidence": [ { "id": "2394", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2394" } ] }, { "disease_id": "DOID:289", "recommended_name": { "id": "DOID:289", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:289", "name": "endometriosis", "description": "A female reproductive system disease characterized by the growth of endometrial tissue outside the uterine body." }, "synonyms": [], "unlinked_id_list": [ "DOID:5166" ], "evidence": [ { "id": "289", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:289" } ] }, { "disease_id": "DOID:4450", "recommended_name": { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "renal cell carcinoma", "description": "A renal carcinoma that has_material_basis_in the lining of the proximal convoluted renal tubule of the kidney." }, "synonyms": [ { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "RCC", "description": "" }, { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "adenocarcinoma of kidney", "description": "" }, { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "hypernephroma", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "renal cell carcinoma, Xp11-associated", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "renal cell carcinoma, Xp11-associated", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "renal cell carcinoma, papillary, 1", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "RCCX1", "description": "" }, { "id": "MIM:300854", "resource": "MIM", "url": "https://www.omim.org/entry/300854", "name": "Renal cell carcinoma Xp11-associated", "description": "Renal cell carcinoma Xp11-associated" } ], "unlinked_id_list": [ "DOID:4455" ], "evidence": [ { "id": "4450", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4450" } ] }, { "disease_id": "DOID:535", "recommended_name": { "id": "DOID:535", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:535", "name": "sleep disorder", "description": "A disease of mental health that involves disruption of sleep patterns." }, "synonyms": [ { "id": "DOID:535", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:535", "name": "Non-organic sleep disorder", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "535", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:535" } ] }, { "disease_id": "DOID:5844", "recommended_name": { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "myocardial infarction", "description": "A coronary artery disease characterized by myocardial cell death (myocardial necrosis) due to prolonged ischaemia." }, "synonyms": [ { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "Myocardial infarct", "description": "" }, { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "heart attack", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "Mci2", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "5844", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5844" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "ghrh", "url": "https://www.uniprot.org/uniprotkb/A0A181", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-070426-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070426-1", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000069481", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000069481", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "791105", "url": "https://www.ncbi.nlm.nih.gov/gene/791105", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000532", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000532", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046963", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046963", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:791105", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:791105", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A181", "url": "https://www.orthodb.org/?gene=A0A181", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11213", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11213", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11213:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11213:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00123", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00123", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A181", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:PR_A0A181", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DRE-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-DRE-420092", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001073561", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073561", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A181-1", "url": "https://www.uniprot.org/uniprotkb/A0A181-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-070426-1", "url": "https://zfin.org/ZDB-GENE-070426-1", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MQVGVIQRTALLVLCCLLLSASSSPVYPALKFGRHADAIFTNSYRKVLGQISARKFLQTVMGKRLGPETESNVKRQSSMYGNTYKQDVDMNVIESEQSYRDPQKFKFALIMH", "length": 112, "header": "tr|A0A181-1|A0A181_DANRE Isoform 1 of Somatoliberin OS=Danio rerio OX=7955 GN=ghrh PE=2 SV=1 CANONICAL=A0A181-1" }, "isoforms": [ { "isoform_ac": "A0A181-1", "url": "https://www.uniprot.org/uniprotkb/A0A181/entry#A0A181-1", "sequence": { "sequence": "MQVGVIQRTALLVLCCLLLSASSSPVYPALKFGRHADAIFTNSYRKVLGQISARKFLQTVMGKRLGPETESNVKRQSSMYGNTYKQDVDMNVIESEQSYRDPQKFKFALIMH", "length": 112, "header": "tr|A0A181-1|A0A181_DANRE Isoform 1 of Somatoliberin OS=Danio rerio OX=7955 GN=ghrh PE=2 SV=1 CANONICAL=A0A181-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Identification of the endogenous ligands for chicken growth hormone-releasing hormone (GHRH) receptor: evidence for a separate gene encoding GHRH in submammalian vertebrates.", "journal": "Endocrinology", "date": "2007", "authors": "Wang Yajun, Li Juan, Wang Crystal Ying, Kwok Amy Ho Yan, Leung Frederick C", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "17272401", "url": "https://glygen.org/publication/PubMed/17272401" } ] }, { "title": "Discovery of growth hormone-releasing hormones and receptors in nonmammalian vertebrates.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Lee Leo T O, Siu Francis K Y, Tam Janice K V, Lau Ivy T Y, Wong Anderson O L, Lin Marie C M, Vaudry Hubert, Chow Billy K C", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "17283332", "url": "https://glygen.org/publication/PubMed/17283332" } ] }, { "title": "Distribution of growth hormone-releasing hormone-like peptide: Immunoreactivity in the central nervous system of the adult zebrafish (Danio rerio).", "journal": "J. Comp. Neurol.", "date": "2009", "authors": "Castro Antonio, Becerra Manuela, Manso Mar\u00eda Jes\u00fas, Tello Javier, Sherwood Nancy M, Anad\u00f3n Ram\u00f3n", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "19235874", "url": "https://glygen.org/publication/PubMed/19235874" } ] }, { "title": "Human cardiomyopathy mutations induce myocyte hyperplasia and activate hypertrophic pathways during cardiogenesis in zebrafish.", "journal": "Dis. Model. Mech.", "date": "2011", "authors": "Becker Jason R, Deo Rahul C, Werdich Andreas A, Pan\u00e0kov\u00e0 Daniela, Coy Shannon, MacRae Calum A", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "21245263", "url": "https://glygen.org/publication/PubMed/21245263" } ] }, { "title": "AgRP and POMC neurons are hypophysiotropic and coordinately regulate multiple endocrine axes in a larval teleost.", "journal": "Cell Metab.", "date": "2012", "authors": "Zhang Chao, Forlano Paul M, Cone Roger D", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "22245570", "url": "https://glygen.org/publication/PubMed/22245570" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Parental exposure to triphenyltin inhibits growth and disrupts thyroid function in zebrafish larvae.", "journal": "Chemosphere", "date": "2020", "authors": "Li Ping, Li Zhi-Hua, Zhong Liqiao", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "31568941", "url": "https://glygen.org/publication/PubMed/31568941" } ] }, { "title": "Environmentally relevant concentrations of geosmin affect the development, oxidative stress, apoptosis and endocrine disruption of embryo-larval zebrafish.", "journal": "Sci. Total Environ.", "date": "2020", "authors": "Zhou Weicheng, Wang Jinglong, Zhang Jinli, Peng Chengrong, Li Genbao, Li Dunhai", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "32473435", "url": "https://glygen.org/publication/PubMed/32473435" } ] }, { "title": "Bsx Is Essential for Differentiation of Multiple Neuromodulatory Cell Populations in the Secondary Prosencephalon.", "journal": "Front. Neurosci.", "date": "2020", "authors": "Schredelseker Theresa, Veit Florian, Dorsky Richard I, Driever Wolfgang", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "32581684", "url": "https://glygen.org/publication/PubMed/32581684" } ] }, { "title": "Vitamin D deficiency serves as a precursor to stunted growth and central adiposity in zebrafish.", "journal": "Sci. Rep.", "date": "2020", "authors": "Knuth Megan M, Mahapatra Debabrata, Jima Dereje, Wan Debin, Hammock Bruce D, Law Mac, Kullman Seth W", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "32994480", "url": "https://glygen.org/publication/PubMed/32994480" } ] }, { "title": "Mutation of spexin2 promotes feeding, somatic growth, adiposity, and insulin resistance in zebrafish.", "journal": "Am. J. Physiol. Regul. Integr. Comp. Physiol.", "date": "2022", "authors": "Zhao Tingting, Ye Zhifeng, Liu Yun, Lin Haoran, Li Shuisheng, Zhang Yong", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "reference": [ { "type": "PubMed", "id": "35293264", "url": "https://glygen.org/publication/PubMed/35293264" } ] } ], "pathway": [ { "id": "dre:791105", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:791105", "resource": "KEGG Pathway" }, { "id": "R-DRE-420092", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-DRE-420092", "resource": "Reactome", "description": "Glucagon-type ligand receptors" } ], "orthologs": [ { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG", "length": 108 }, "evidence": [ { "id": "ZFIN:ZDB-GENE-070426-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070426-1#orthology", "database": "AGR" }, { "id": "RGD:61883", "url": "https://alliancegenome.org/gene/RGD:61883#orthology", "database": "AGR" }, { "id": "MGI:95709", "url": "https://alliancegenome.org/gene/MGI:95709#orthology", "database": "AGR" }, { "id": "HGNC:4265", "url": "https://alliancegenome.org/gene/HGNC:4265#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P09916-1", "protein_name": "Somatoliberin", "gene_name": "Ghrh", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPLWVFFVLLTLTSGSHCSLPPSPPFRVRRHADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFNRHLDRVWAEDKQMALESILQGFPRMKLSAEA", "length": 104 }, "evidence": [ { "id": "ZFIN:ZDB-GENE-070426-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070426-1#orthology", "database": "AGR" }, { "id": "RGD:61883", "url": "https://alliancegenome.org/gene/RGD:61883#orthology", "database": "AGR" }, { "id": "MGI:95709", "url": "https://alliancegenome.org/gene/MGI:95709#orthology", "database": "AGR" }, { "id": "HGNC:4265", "url": "https://alliancegenome.org/gene/HGNC:4265#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P16043-1", "protein_name": "Somatoliberin", "gene_name": "Ghrh", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLLWVLFVILILTSGSHCSLPPSPPFRMQRHVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLSRQEDSMWTEDKQMTLESILQGFPRMKPSADA", "length": 103 }, "evidence": [ { "id": "ZFIN:ZDB-GENE-070426-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070426-1#orthology", "database": "AGR" }, { "id": "RGD:61883", "url": "https://alliancegenome.org/gene/RGD:61883#orthology", "database": "AGR" }, { "id": "MGI:95709", "url": "https://alliancegenome.org/gene/MGI:95709#orthology", "database": "AGR" }, { "id": "HGNC:4265", "url": "https://alliancegenome.org/gene/HGNC:4265#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "growth hormone-releasing hormone receptor binding", "id": "GO:0031770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031770", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" }, { "name": "neuropeptide hormone activity", "id": "GO:0005184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005184", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" }, { "name": "peptide hormone receptor binding", "id": "GO:0051428", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051428", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" }, { "name": "growth hormone-releasing hormone activity", "id": "GO:0016608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016608", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" }, { "name": "terminal bouton", "id": "GO:0043195", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043195", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" }, { "name": "perikaryon", "id": "GO:0043204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043204", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" }, { "name": "adenylate cyclase-activating G protein-coupled receptor signaling pathway", "id": "GO:0007189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007189", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" }, { "name": "regulation of protein localization", "id": "GO:0032880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032880", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" }, { "name": "growth hormone secretion", "id": "GO:0030252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030252", "evidence": [ { "database": "UniProtKB", "id": "A0A181", "url": "https://www.uniprot.org/uniprotkb/A0A181" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }