{ "uniprot_canonical_ac": "A0A178WF56-1", "uniprot_ac": "A0A178WF56", "uniprot_id": "CSTM3_ARATH", "mass": { "chemical_mass": 7812.0, "monoisotopic_mass": 7812.0 }, "refseq": { "ac": "NP_176002", "name": "cysteine-rich/transmembrane domain protein B", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_176002" }, "gene_names": [ { "name": "ATHCYSTM3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56", "id": "A0A178WF56" }, { "name": "CYSTM3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56", "id": "A0A178WF56" }, { "name": "T6H22.17; T6H22_17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_176002", "id": "NP_176002" }, { "name": "T6H22.17", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56", "id": "A0A178WF56" }, { "name": "T6H22_17", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56", "id": "A0A178WF56" } ], "protein_names": [ { "name": "Protein CYSTEINE-RICH TRANSMEMBRANE MODULE 3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56/entry#names_and_taxonomy", "id": "A0A178WF56" }, { "name": "AthCYSTM3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56/entry#names_and_taxonomy", "id": "A0A178WF56" }, { "name": "cysteine-rich/transmembrane domain protein B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_176002", "id": "NP_176002" } ], "function": [ { "annotation": "Negatively regulates salt stress responses and Na(+) homeostasis (PubMed:29272523, PubMed:30701352). Prevents Na(+) efflux, disturbs reactive oxygen species (ROS) homeostasis, and represses the expression of nuclear salt stress-responsive genes (PubMed:30701352). Involved in resistance to abiotic stress (PubMed:29272523).", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56#function" }, { "database": "PubMed", "id": "29272523", "url": "https://glygen.org/publication/PubMed/29272523" }, { "database": "PubMed", "id": "30701352", "url": "https://glygen.org/publication/PubMed/30701352" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "gene": [ { "name": "CYSTM3", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56", "locus": {} } ], "crossref": [ { "id": "A0A178WF56", "url": "https://alphafold.ebi.ac.uk/entry/A0A178WF56", "database": "AlphaFoldDB", "categories": [] }, { "id": "AT1G56060", "url": "https://bar.utoronto.ca/thalemine/portal.do?externalids=AT1G56060", "database": "Araport", "categories": [ "Protein", "Organism-specific" ] }, { "id": "842057", "url": "https://www.ncbi.nlm.nih.gov/gene/842057", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR028144", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028144", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ath:AT1G56060", "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT1G56060", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VMMNDSP", "url": "https://omabrowser.org/oma/group/VMMNDSP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A178WF56", "url": "https://www.orthodb.org/?gene=A0A178WF56", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "F4I3J1", "url": "https://www.orthodb.org/?gene=F4I3J1", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR31568", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31568", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR31568:SF89", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31568:SF89", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF12734", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12734", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A178WF56", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:PR_A0A178WF56", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_176002", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_176002", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "AT1G56060", "url": "https://www.arabidopsis.org/servlets/TairObject?type=locus&name=AT1G56060", "database": "TAIR", "categories": [ "Protein", "Organism-specific" ] }, { "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A178WF56-1", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F4I3J1", "url": "https://www.uniprot.org/uniprotkb/F4I3J1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F4I3J1-1", "url": "https://www.uniprot.org/uniprotkb/F4I3J1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQYHQQHEMKQTMAETQYVTAPPPMGYPVMMKDSPQTVQPPHEGQSKGSGGFLRGCLAAMCCCCVLDCVF", "length": 71, "header": "sp|A0A178WF56-1|CSTM3_ARATH Isoform 1 of Protein CYSTEINE-RICH TRANSMEMBRANE MODULE 3 OS=Arabidopsis thaliana OX=3702 GN=CYSTM3 PE=1 SV=1 CANONICAL=A0A178WF56-1" }, "isoforms": [ { "isoform_ac": "A0A178WF56-1", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56/entry#A0A178WF56-1", "sequence": { "sequence": "MAQYHQQHEMKQTMAETQYVTAPPPMGYPVMMKDSPQTVQPPHEGQSKGSGGFLRGCLAAMCCCCVLDCVF", "length": 71, "header": "sp|A0A178WF56-1|CSTM3_ARATH Isoform 1 of Protein CYSTEINE-RICH TRANSMEMBRANE MODULE 3 OS=Arabidopsis thaliana OX=3702 GN=CYSTM3 PE=1 SV=1 CANONICAL=A0A178WF56-1" }, "locus": { "chromosome": "1", "start_pos": 20966611, "end_pos": 20967162, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "AT1G56060.2", "url": "https://www.ensemblgenomes.org/id/AT1G56060.2" }, { "database": "Ensembl Peptide", "id": "AT1G56060.2", "url": "https://www.ensemblgenomes.org/id/AT1G56060.2" } ] } }, { "isoform_ac": "F4I3J1-1", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56/entry#F4I3J1-1", "sequence": { "sequence": "MAQYHQQHEMKQTMAETQYVTAPPPMGYPVMMKDSPQTVQPPHEGQSKGSGGFLRGW", "length": 57, "header": "tr|F4I3J1-1|CSTM3_ARATH Computationally mapped isoform of Protein CYSTEINE-RICH TRANSMEMBRANE MODULE 3 OS=Arabidopsis thaliana OX=3702 GN=CYSTM3 PE=1 SV=2 CANONICAL=A0A178WF56-1" }, "locus": { "chromosome": "1", "start_pos": 20966528, "end_pos": 20967180, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "AT1G56060.1", "url": "https://www.ensemblgenomes.org/id/AT1G56060.1" }, { "database": "Ensembl Peptide", "id": "AT1G56060.1", "url": "https://www.ensemblgenomes.org/id/AT1G56060.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 35, "end_pos": 35, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "A0A178WF56", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0A178WF56" }, { "database": "PubMed", "id": "30833711", "url": "https://glygen.org/publication/PubMed/30833711" } ], "site_lbl": "Ser35" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.", "journal": "Nature", "date": "2000", "authors": "Theologis A, Ecker J R, Palm C J, Federspiel N A, Kaul S, White O, Alonso J, Altafi H, Araujo R, Bowman C L, Brooks S Y, Buehler E, Chan A, Chao Q, Chen H, Cheuk R F, Chin C W, Chung M K, Conn L, Conway A B, Conway A R, Creasy T H, Dewar K, Dunn P, Etgu P, Feldblyum T V, Feng J, Fong B, Fujii C Y, Gill J E, Goldsmith A D, Haas B, Hansen N F, Hughes B, Huizar L, Hunter J L, Jenkins J, Johnson-Hopson C, Khan S, Khaykin E, Kim C J, Koo H L, Kremenetskaia I, Kurtz D B, Kwan A, Lam B, Langin-Hooper S, Lee A, Lee J M, Lenz C A, Li J H, Li Y, Lin X, Liu S X, Liu Z A, Luros J S, Maiti R, Marziali A, Militscher J, Miranda M, Nguyen M, Nierman W C, Osborne B I, Pai G, Peterson J, Pham P K, Rizzo M, Rooney T, Rowley D, Sakano H, Salzberg S L, Schwartz J R, Shinn P, Southwick A M, Sun H, Tallon L J, Tambunga G, Toriumi M J, Town C D, Utterback T, Van Aken S, Vaysberg M, Vysotskaia V S, Walker M, Wu D, Yu G, Fraser C M, Venter J C, Davis R W", "evidence": [ { "database": "UniProtKB", "id": "F4I3J1", "url": "https://www.uniprot.org/uniprotkb/F4I3J1" } ], "reference": [ { "type": "PubMed", "id": "11130712", "url": "https://glygen.org/publication/PubMed/11130712" } ] }, { "title": "Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.", "journal": "Plant J.", "date": "2017", "authors": "Cheng Chia-Yi, Krishnakumar Vivek, Chan Agnes P, Thibaud-Nissen Fran\u00e7oise, Schobel Seth, Town Christopher D", "evidence": [ { "database": "UniProtKB", "id": "F4I3J1", "url": "https://www.uniprot.org/uniprotkb/F4I3J1" } ], "reference": [ { "type": "PubMed", "id": "27862469", "url": "https://glygen.org/publication/PubMed/27862469" } ] }, { "title": "CYSTM, a Novel Non-Secreted Cysteine-Rich Peptide Family, Involved in Environmental Stresses in Arabidopsis thaliana.", "journal": "Plant & cell physiology", "date": "2018-02-01", "authors": "Xu Yang, Yu Zipeng, Zhang Di, Huang Jinguang, Wu Changai, Yang Guodong, Yan Kang, Zhang Shizhong, Zheng Chengchao", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "reference": [ { "type": "PubMed", "id": "29272523", "url": "https://glygen.org/publication/PubMed/29272523" } ] }, { "title": "CYSTM3 negatively regulates salt stress tolerance in Arabidopsis.", "journal": "Plant molecular biology", "date": "2019-03", "authors": "Xu Yang, Yu Zipeng, Zhang Shizhong, Wu Changai, Yang Guodong, Yan Kang, Zheng Chengchao, Huang Jinguang", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "reference": [ { "type": "PubMed", "id": "30701352", "url": "https://glygen.org/publication/PubMed/30701352" } ] }, { "title": "Capturing the phosphorylation and protein interaction landscape of the plant TOR kinase.", "journal": "Nature plants", "date": "2019-03", "authors": "Van Leene Jelle, Han Chao, Gadeyne Astrid, Eeckhout Dominique, Matthijs Caroline, Cannoot Bernard, De Winne Nancy, Persiau Geert, Van De Slijke Eveline, Van de Cotte Brigitte, Stes Elisabeth, Van Bel Michiel, Storme Veronique, Impens Francis, Gevaert Kris, Vandepoele Klaas, De Smet Ive, De Jaeger Geert", "evidence": [ { "database": "iPTMnet", "id": "A0A178WF56", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0A178WF56" } ], "reference": [ { "type": "PubMed", "id": "30833711", "url": "https://glygen.org/publication/PubMed/30833711" } ] } ], "pathway": [ { "id": "ath:AT1G56060", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT1G56060", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "regulation of response to salt stress", "id": "GO:1901000", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901000", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "pmid": "" }, { "name": "response to salt stress", "id": "GO:0009651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009651", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "pmid": "" }, { "name": "sodium ion homeostasis", "id": "GO:0055078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055078", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "pmid": "" }, { "name": "regulation of reactive oxygen species biosynthetic process", "id": "GO:1903426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903426", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "pmid": "" }, { "name": "negative regulation of response to salt stress", "id": "GO:1901001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901001", "evidence": [ { "database": "UniProtKB", "id": "A0A178WF56", "url": "https://www.uniprot.org/uniprotkb/A0A178WF56" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A178WF56-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 71, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A178WF56-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A178WF56" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 35 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }