{ "uniprot_canonical_ac": "A0A142FJB3-1", "uniprot_ac": "A0A142FJB3", "uniprot_id": "A0A142FJB3_PIG", "mass": { "chemical_mass": 20200.0, "monoisotopic_mass": 20200.0 }, "refseq": {}, "gene_names": [ { "name": "IL17B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3", "id": "A0A142FJB3" } ], "protein_names": [ { "name": "Interleukin-17B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3/entry#names_and_taxonomy", "id": "A0A142FJB3" }, { "name": "Neuronal interleukin-17-related factor", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3/entry#names_and_taxonomy", "id": "A0A142FJB3" } ], "function": [ { "annotation": "Stimulates the release of tumor necrosis factor alpha and IL-1-beta from the monocytic cell line THP-1.", "evidence": [ { "database": "UniProtKB", "id": "A0A142FJB3", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3#function" }, { "database": "UniProtKB", "id": "ARBA00055829", "url": "https://www.uniprot.org/uniprotkb/ARBA00055829#function" }, { "database": "UniProtKB", "id": "F1RL92", "url": "https://www.uniprot.org/uniprotkb/F1RL92#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A142FJB3", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "IL17B", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3", "locus": { "chromosome": "2", "start_pos": 150541180, "end_pos": 150545367, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000014434", "url": "https://www.ensembl.org/id/ENSSSCG00000014434" } ] } } ], "crossref": [ { "id": "ENSSSCG00000014434", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000014434", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR010345", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010345", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020440", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020440", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "WPHNLLL", "url": "https://omabrowser.org/oma/group/WPHNLLL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PF06083", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF06083", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A142FJB3", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A142FJB3-1", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1RL92", "url": "https://www.uniprot.org/uniprotkb/F1RL92", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1RL92-1", "url": "https://www.uniprot.org/uniprotkb/F1RL92-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDWLHHLLLLLTISVFLGLGQPRNPKGKRKGQGRPGTLAPGPQQVPLDLVSRAKPFARMEEYEKNLGDMVAQLRNSSELAKRKCEVNLQLWLSNQRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPLPPRTGPCRQRAVMETIAVGCTCIF", "length": 180, "header": "tr|A0A142FJB3-1|A0A142FJB3_PIG Isoform 1 of Interleukin-17B OS=Sus scrofa OX=9823 GN=IL17B PE=2 SV=1 CANONICAL=A0A142FJB3-1" }, "isoforms": [ { "isoform_ac": "A0A142FJB3-1", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3/entry#A0A142FJB3-1", "sequence": { "sequence": "MDWLHHLLLLLTISVFLGLGQPRNPKGKRKGQGRPGTLAPGPQQVPLDLVSRAKPFARMEEYEKNLGDMVAQLRNSSELAKRKCEVNLQLWLSNQRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPLPPRTGPCRQRAVMETIAVGCTCIF", "length": 180, "header": "tr|A0A142FJB3-1|A0A142FJB3_PIG Isoform 1 of Interleukin-17B OS=Sus scrofa OX=9823 GN=IL17B PE=2 SV=1 CANONICAL=A0A142FJB3-1" }, "locus": {} }, { "isoform_ac": "F1RL92-1", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3/entry#F1RL92-1", "sequence": { "sequence": "LLLLTISVFLGLGQPRNPKGKRKGQGRPGTLAPGPQQVPLDLVSRAKPFARMEEYEKNLGDMVAQLRNSSELAKRKCEVNLQLWLSNQRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPLPPRTGPCRQRAVMETIAVGCTCIF", "length": 173, "header": "tr|F1RL92-1|F1RL92_PIG Computationally mapped isoform of Interleukin-17B OS=Sus scrofa OX=9823 GN=IL17B PE=3 SV=2 CANONICAL=A0A142FJB3-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A3Q1MCU5-1", "protein_name": "Interleukin-17B", "gene_name": "IL17B", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MDLALVRAHRFRNMFTASLNCAENMPRKATWGVDKALPGDQLFLLTISIFLGLGQPRNPKGKRKGPGRPGTLAPGPHQLPLDLVSRAKPYARMEEYERNLAEMVAQLRNSSEPARRKCEVNLQLWLSNKRSLSPWGYSINHDPSRVPADLPEAQCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRPGPCRQRAVMETIAVGCTCIF", "length": 214 }, "evidence": [ { "id": "A0A142FJB3", "url": "https://omabrowser.org/oma/group/A0A142FJB3/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "G3V8K9-1", "protein_name": "Interleukin-17B", "gene_name": "Il17b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDWPHSLLFLLAISIFLVPSQPRNTKGKRKGQGRPGPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPEDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF", "length": 180 }, "evidence": [ { "id": "A0A142FJB3", "url": "https://omabrowser.org/oma/group/A0A142FJB3/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9QXT6-1", "protein_name": "Interleukin-17B", "gene_name": "Il17b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDWPHSLLFLLAISIFLAPSHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF", "length": 180 }, "evidence": [ { "id": "A0A142FJB3", "url": "https://omabrowser.org/oma/group/A0A142FJB3/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UHF5-1", "protein_name": "Interleukin-17B", "gene_name": "IL17B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF", "length": 180 }, "evidence": [ { "id": "A0A142FJB3", "url": "https://omabrowser.org/oma/group/A0A142FJB3/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A142FJB3", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "A0A142FJB3", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3" } ], "pmid": "" }, { "name": "positive regulation of cytokine production involved in inflammatory response", "id": "GO:1900017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900017", "evidence": [ { "database": "UniProtKB", "id": "A0A142FJB3", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "A0A142FJB3", "url": "https://www.uniprot.org/uniprotkb/A0A142FJB3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 75, "end_pos": 77, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 75, "end_pos": 77 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }