{ "uniprot_canonical_ac": "A0A140JWM8-1", "uniprot_ac": "A0A140JWM8", "uniprot_id": "C7162_ARATH", "mass": { "chemical_mass": 54323.0, "monoisotopic_mass": 54323.0 }, "refseq": { "ac": "NP_198462", "name": "Cytochrome P450 superfamily protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_198462" }, "gene_names": [ { "name": "CYP716A2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8", "id": "A0A140JWM8" }, { "name": "MAB16.8; MAB16_8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_198462", "id": "NP_198462" }, { "name": "MAB16.9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8", "id": "A0A140JWM8" } ], "protein_names": [ { "name": "Cytochrome P450 716A2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8/entry#names_and_taxonomy", "id": "A0A140JWM8" }, { "name": "1.14.-.-", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8/entry#names_and_taxonomy", "id": "A0A140JWM8" }, { "name": "Cytochrome P450 superfamily protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_198462", "id": "NP_198462" } ], "function": [ { "annotation": "Possesses triterpene oxidizing activity. Catalyzes the C28 hydroxylation of alpha-amyrin, beta-amyrin, and lupeol, producing uvaol, erythrodiol, and betulin, respectively. Catalyzes the C28 carboxylation of alpha- and beta-amyrin. Possesses 22alpha-hydroxylation activity against alpha- and beta-amaryn.", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8#function" }, { "database": "PubMed", "id": "26801524", "url": "https://glygen.org/publication/PubMed/26801524" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "gene": [ { "name": "CYP716A2", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8", "locus": { "chromosome": "CP002688.1", "start_pos": 14212174, "end_pos": 14213293, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "AT5G36140", "url": "https://www.ensemblgenomes.org/id/AT5G36140" } ] } } ], "crossref": [ { "id": "A0A140JWM8", "url": "https://alphafold.ebi.ac.uk/entry/A0A140JWM8", "database": "AlphaFoldDB", "categories": [] }, { "id": "AT5G36130", "url": "https://bar.utoronto.ca/thalemine/portal.do?externalids=AT5G36130", "database": "Araport", "categories": [ "Protein", "Organism-specific" ] }, { "id": "AT5G36140", "url": "https://bar.utoronto.ca/thalemine/portal.do?externalids=AT5G36140", "database": "Araport", "categories": [ "Protein", "Organism-specific" ] }, { "id": "cd11043", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11043", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "833611", "url": "https://www.ncbi.nlm.nih.gov/gene/833611", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001128", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001128", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002401", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002401", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017972", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017972", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036396", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036396", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ath:AT5G36130", "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT5G36130", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ath:AT5G36140", "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT5G36140", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR24286", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24286", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24286:SF349", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24286:SF349", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00067", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00067", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A140JWM8", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:PR_A0A140JWM8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_198462", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_198462", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "AT5G36130", "url": "https://www.arabidopsis.org/servlets/TairObject?type=locus&name=AT5G36130", "database": "TAIR", "categories": [ "Protein", "Organism-specific" ] }, { "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140JWM8-1", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYLTIIFLFISSIIFPLLFFLGKHLSNFRYPNLPPGKIGFPLIGETLSFLSAGRQGHPEKFVTDRVRHFSSGIFKTHLFGSPFAVVTGASGNKFLFTNENKLVISWWPDSVNKIFPSSTQTSSKEEAIKTRMLLMPSMKPEALRRYVGVMDEIAQKHFETEWANQDQLIVFPLTKKFTFSIACRLFLSMDDLERVRKLEEPFTTVMTGVFSIPIDLPGTRFNRAIKASRLLSKEVSTIIRQRKEELKAGKVSVEQDILSHMLMNIGETKDEDLADKIIALLIGGHDTTSIVCTFVVNYLAEFPHIYQRVLEEQKEILNNKDVNEKLTWEDIEKMRYSWNVACEVMRIVPPLAGTFREAIDHFSFKGFYIPKGWKLYWSATATHKNPEYFPEPEKFEPSRFEGSGPKPYTYVPFGGGSRICPGREYARLEILIFMHNLVKRFKWEKVFPKENKLVADPAPIPAKGLPIRIFPQS", "length": 473, "header": "sp|A0A140JWM8-1|C7162_ARATH Isoform 1 of Cytochrome P450 716A2 OS=Arabidopsis thaliana OX=3702 GN=CYP716A2 PE=2 SV=1 CANONICAL=A0A140JWM8-1" }, "isoforms": [ { "isoform_ac": "A0A140JWM8-1", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8/entry#A0A140JWM8-1", "sequence": { "sequence": "MYLTIIFLFISSIIFPLLFFLGKHLSNFRYPNLPPGKIGFPLIGETLSFLSAGRQGHPEKFVTDRVRHFSSGIFKTHLFGSPFAVVTGASGNKFLFTNENKLVISWWPDSVNKIFPSSTQTSSKEEAIKTRMLLMPSMKPEALRRYVGVMDEIAQKHFETEWANQDQLIVFPLTKKFTFSIACRLFLSMDDLERVRKLEEPFTTVMTGVFSIPIDLPGTRFNRAIKASRLLSKEVSTIIRQRKEELKAGKVSVEQDILSHMLMNIGETKDEDLADKIIALLIGGHDTTSIVCTFVVNYLAEFPHIYQRVLEEQKEILNNKDVNEKLTWEDIEKMRYSWNVACEVMRIVPPLAGTFREAIDHFSFKGFYIPKGWKLYWSATATHKNPEYFPEPEKFEPSRFEGSGPKPYTYVPFGGGSRICPGREYARLEILIFMHNLVKRFKWEKVFPKENKLVADPAPIPAKGLPIRIFPQS", "length": 473, "header": "sp|A0A140JWM8-1|C7162_ARATH Isoform 1 of Cytochrome P450 716A2 OS=Arabidopsis thaliana OX=3702 GN=CYP716A2 PE=2 SV=1 CANONICAL=A0A140JWM8-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Structural analysis of Arabidopsis thaliana chromosome 5. X. Sequence features of the regions of 3,076,755 bp covered by sixty P1 and TAC clones.", "journal": "DNA Res.", "date": "2000", "authors": "Sato S, Nakamura Y, Kaneko T, Katoh T, Asamizu E, Kotani H, Tabata S", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "reference": [ { "type": "PubMed", "id": "10718197", "url": "https://glygen.org/publication/PubMed/10718197" } ] }, { "title": "Novel triterpene oxidizing activity of Arabidopsis thaliana CYP716A subfamily enzymes.", "journal": "FEBS letters", "date": "2016-02", "authors": "Yasumoto Shuhei, Fukushima Ery O, Seki Hikaru, Muranaka Toshiya", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "reference": [ { "type": "PubMed", "id": "26801524", "url": "https://glygen.org/publication/PubMed/26801524" } ] }, { "title": "Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.", "journal": "Plant J.", "date": "2017", "authors": "Cheng Chia-Yi, Krishnakumar Vivek, Chan Agnes P, Thibaud-Nissen Fran\u00e7oise, Schobel Seth, Town Christopher D", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "reference": [ { "type": "PubMed", "id": "27862469", "url": "https://glygen.org/publication/PubMed/27862469" } ] } ], "pathway": [ { "id": "ath:AT5G36130", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT5G36130", "resource": "KEGG Pathway" }, { "id": "ath:AT5G36140", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT5G36140", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen", "id": "GO:0016709", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016709", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "pmid": "" }, { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "pmid": "" }, { "name": "monooxygenase activity", "id": "GO:0004497", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004497", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "triterpenoid metabolic process", "id": "GO:0006722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006722", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "pmid": "" }, { "name": "saponin biosynthetic process", "id": "GO:0016135", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016135", "evidence": [ { "database": "UniProtKB", "id": "A0A140JWM8", "url": "https://www.uniprot.org/uniprotkb/A0A140JWM8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A140JWM8-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 473, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A140JWM8-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A140JWM8" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }