{ "uniprot_canonical_ac": "A0A0R4IXF0-1", "uniprot_ac": "A0A0R4IXF0", "uniprot_id": "A0A0R4IXF0_DANRE", "mass": { "chemical_mass": 22111.0, "monoisotopic_mass": 22111.0 }, "refseq": { "ac": "NP_001373289", "name": "FAS-associated death domain protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001373289" }, "gene_names": [ { "name": "fadd", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0", "id": "A0A0R4IXF0" }, { "name": "fadd", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001373289", "id": "NP_001373289" } ], "protein_names": [ { "name": "FAS-associated death domain protein", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0/entry#names_and_taxonomy", "id": "A0A0R4IXF0" }, { "name": "FAS-associated death domain protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001373289", "id": "NP_001373289" }, { "name": "FAS-associating death domain-containing protein", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0/entry#names_and_taxonomy", "id": "A0A0R4IXF0" }, { "name": "Fas-associated death domain protein", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0/entry#names_and_taxonomy", "id": "A0A0R4IXF0" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: BC114285.1, EE111276.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505375, SAMEA4476736 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JBMGRA010000007.1. On Aug 21, 2020 this sequence version replaced XP_001923893.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.", "evidence": [ { "database": "RefSeq", "id": "NP_001373289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001373289" } ] }, { "annotation": "Apoptotic adapter molecule that recruits caspases CASP8 or CASP10 to the activated FAS/CD95 or TNFRSF1A/TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs CASP8 proteolytic activation. Active CASP8 initiates the subsequent cascade of caspases mediating apoptosis. Involved in interferon-mediated antiviral immune response, playing a role in the positive regulation of interferon signaling.", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0#function" }, { "database": "UniProtKB", "id": "ARBA00059068", "url": "https://www.uniprot.org/uniprotkb/ARBA00059068#function" } ] }, { "annotation": "Establish that pax2 in combination with vax2 directly regulate the fas-associated death domain (fadd) gene", "evidence": [ { "database": "RefSeq", "id": "NP_001373289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001373289" }, { "database": "PubMed", "id": "22357656", "url": "https://glygen.org/publication/PubMed/22357656" } ] } ], "disease": [ { "disease_id": "DOID:0061060", "recommended_name": { "id": "DOID:0061060", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0061060", "name": "immunodeficiency 90", "description": "A primary immunodeficiency disease that is characterized by infancy or early childhood with recurrent fevers and bacterial or viral infections associated with central nervous system symptoms, including irritability, drowsiness, variable seizures, and white matter abnormalities on brain imaging and that has_material_basis_in homozygous or compound heterozygous mutation in the FADD gene on chromosome 11q13." }, "synonyms": [ { "id": "DOID:0061060", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0061060", "name": "immunodeficiency 90 with encephalopathy, functional hyposplenia, and hepatic dysfunction", "description": "" }, { "id": "MONDO:0013408", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013408", "name": "FADD-related immunodeficiency", "description": "A rare genetic immunological disease reported in a single consanguineous Pakistani family with several affected members presenting with severe bacterial and viral infections, recurrent hepatopathy (portal inflammation, fibrosis), and recurrent, stereotypical febrile episodes, sometimes lasting several days, with encephalopathy and difficult-to-control seizures. Variable cardiac malformations were also reported. Although there were autoimmune lymphoproliferative syndrome (ALPS)-like biological features, clinical ALPS was not present. A homozygous missense mutation in the FADD gene (11q13.3) was found in the family and the disease is thought to follow an autosomal recessive pattern of inheritance." }, { "id": "MONDO:0013408", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013408", "name": "FADD-related immunodeficiency", "description": "" }, { "id": "MONDO:0013408", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013408", "name": "immunodeficiency 90 with encephalopathy, functional hyposplenia, and hepatic dysfunction", "description": "" }, { "id": "MONDO:0013408", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013408", "name": "Fadd deficiency", "description": "" }, { "id": "MONDO:0013408", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013408", "name": "infections, recurrent, with encephalopathy, hepatic dysfunction, and cardiovascular malformations", "description": "" }, { "id": "MIM:613759", "resource": "MIM", "url": "https://www.omim.org/entry/613759", "name": "Infections, recurrent, associated with encephalopathy, hepatic dysfunction and cardiovascular malformations", "description": "Infections, recurrent, associated with encephalopathy, hepatic dysfunction and cardiovascular malformations" } ], "unlinked_id_list": [], "evidence": [ { "id": "0061060", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0061060" } ] }, { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "10652", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:1240", "recommended_name": { "id": "DOID:1240", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1240", "name": "leukemia", "description": "A cancer that affects the blood or bone marrow characterized by an abnormal proliferation of blood cells." }, "synonyms": [], "unlinked_id_list": [ "DOID:1036", "DOID:0080638", "DOID:7757", "DOID:5604", "DOID:8527", "DOID:1039" ], "evidence": [ { "id": "1240", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1240" } ] }, { "disease_id": "DOID:9119", "recommended_name": { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myeloid leukemia", "description": "A myeloid leukemia that is characterized by the rapid growth of abnormal white blood cells that accumulate in the bone marrow and interfere with the production of normal blood cells." }, "synonyms": [ { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "AML - acute Myeloid Leukemia", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "Leukemia, Myelocytic, acute", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myeloblastic leukaemia", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myeloblastic leukemia", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myelogenous leukaemia", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myelogenous leukemia", "description": "" }, { "id": "DOID:9119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9119", "name": "acute myeloid leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloid leukemia", "description": "Acute myeloid leukemia (AML) is a group of neoplasms arising from precursor cells committed to the myeloid cell-line differentiation. All of them are characterized by clonal expansion of myeloid blasts. AML manifests by fever, pallor, anemia, hemorrhages and recurrent infections." }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "AML", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "AML - acute myeloid leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "AML - acute myeloid leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "ANLL", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute Nonlymphocytic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute Nonlymphocytic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute granulocytic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute granulocytic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloblastic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloblastic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myelocytic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myelocytic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myelogenous leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myelogenous leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myelogenous leukemias", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloid leukaemia (AML)", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloid leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloid leukemia (AML)", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute myeloid leukemia, somatic", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute nonlymphocytic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute nonlymphocytic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "hematopoeitic - acute Myleogenous leukaemia (AML)", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "hematopoeitic - acute Myleogenous leukemia (AML)", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid, reduced survival in, somatic", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid, somatic", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, myelocytic, acute", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "myeloid leukemia, acute", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "myeloid leukemia, acute, M4/M4Eo subtype, somatic", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute non lymphoblastic leukaemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "acute non lymphoblastic leukemia", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myelogenous", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid", "description": "" }, { "id": "MONDO:0018874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018874", "name": "leukemia, acute myeloid, susceptibility to", "description": "" }, { "id": "MIM:601626", "resource": "MIM", "url": "https://www.omim.org/entry/601626", "name": "Leukemia, acute myelogenous", "description": "Leukemia, acute myelogenous" } ], "unlinked_id_list": [], "evidence": [ { "id": "9119", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9119" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "fadd", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0", "locus": {} } ], "crossref": [ { "id": "ENSDARG00000103021", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000103021", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd08306", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08306", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd08336", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08336", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "562317", "url": "https://www.ncbi.nlm.nih.gov/gene/562317", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000488", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000488", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001875", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001875", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011029", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011029", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016729", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016729", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:562317", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:562317", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CKMNLVA", "url": "https://omabrowser.org/oma/group/CKMNLVA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IXF0", "url": "https://www.orthodb.org/?gene=A0A0R4IXF0", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15077", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15077", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15077:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15077:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00531", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00531", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01335", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01335", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001373289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001373289", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IXF0-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-070606-3", "url": "https://zfin.org/ZDB-GENE-070606-3", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MDKRGFRAMLLEISDKLTDDNVAKLKFLCTDVGIGKKKLEKIDTGIELFECLIERTAIGPENTELLRTLLDKVGQTVLIEKIDDYDRQTSRSPAGGLDAKERERINTATEVVVEQLGKKWPSVGRKLGLQQTQLEGIQEKHSRDLEEQVRELIRQWMRIKKENARVEDLIQALRDCKQNLTADLVERKLREL", "length": 192, "header": "tr|A0A0R4IXF0-1|A0A0R4IXF0_DANRE Isoform 1 of FAS-associated death domain protein OS=Danio rerio OX=7955 GN=fadd PE=1 SV=1 CANONICAL=A0A0R4IXF0-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IXF0-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0/entry#A0A0R4IXF0-1", "sequence": { "sequence": "MDKRGFRAMLLEISDKLTDDNVAKLKFLCTDVGIGKKKLEKIDTGIELFECLIERTAIGPENTELLRTLLDKVGQTVLIEKIDDYDRQTSRSPAGGLDAKERERINTATEVVVEQLGKKWPSVGRKLGLQQTQLEGIQEKHSRDLEEQVRELIRQWMRIKKENARVEDLIQALRDCKQNLTADLVERKLREL", "length": 192, "header": "tr|A0A0R4IXF0-1|A0A0R4IXF0_DANRE Isoform 1 of FAS-associated death domain protein OS=Danio rerio OX=7955 GN=fadd PE=1 SV=1 CANONICAL=A0A0R4IXF0-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Delineation of the cell-extrinsic apoptosis pathway in the zebrafish.", "journal": "Cell Death Differ.", "date": "2006", "authors": "Eimon P M, Kratz E, Varfolomeev E, Hymowitz S G, Stern H, Zha J, Ashkenazi A", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "reference": [ { "type": "PubMed", "id": "16888647", "url": "https://glygen.org/publication/PubMed/16888647" } ] }, { "title": "SNP genome scanning localizes oto-dental syndrome to chromosome 11q13 and microdeletions at this locus implicate FGF3 in dental and inner-ear disease and FADD in ocular coloboma.", "journal": "Hum. Mol. Genet.", "date": "2007", "authors": "Gregory-Evans Cheryl Y, Moosajee Mariya, Hodges Matthew D, Mackay Donna S, Game Laurence, Vargesson Neil, Bloch-Zupan Agn\u00e8s, R\u00fcschendorf Franz, Santos-Pinto Lourdes, Wackens Georges, Gregory-Evans Kevin", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "reference": [ { "type": "PubMed", "id": "17656375", "url": "https://glygen.org/publication/PubMed/17656375" } ] }, { "title": "Interruption of cenph causes mitotic failure and embryonic death, and its haploinsufficiency suppresses cancer in zebrafish.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Zhao Xinyi, Zhao Long, Tian Tian, Zhang Yu, Tong Jingyuan, Zheng Xiaofeng, Meng Anming", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "reference": [ { "type": "PubMed", "id": "20573960", "url": "https://glygen.org/publication/PubMed/20573960" } ] }, { "title": "Pax2 regulates a fadd-dependent molecular switch that drives tissue fusion during eye development.", "journal": "Hum. Mol. Genet.", "date": "2012", "authors": "Viringipurampeer Ishaq A, Ferreira Todd, DeMaria Shannon, Yoon Jookyung J, Shan Xianghong, Moosajee Mariya, Gregory-Evans Kevin, Ngai John, Gregory-Evans Cheryl Y", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" }, { "database": "RefSeq", "id": "NP_001373289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001373289" } ], "reference": [ { "type": "PubMed", "id": "22357656", "url": "https://glygen.org/publication/PubMed/22357656" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "The nuclear pore complex function of Sec13 protein is required for cell survival during retinal development.", "journal": "J. Biol. Chem.", "date": "2014", "authors": "Niu Xubo, Hong Jian, Zheng Xiaofeng, Melville David B, Knapik Ela W, Meng Anming, Peng Jinrong", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "reference": [ { "type": "PubMed", "id": "24627485", "url": "https://glygen.org/publication/PubMed/24627485" } ] }, { "title": "Transcriptome comparison reveals a genetic network regulating the lower temperature limit in fish.", "journal": "Sci. Rep.", "date": "2016", "authors": "Hu Peng, Liu Mingli, Liu Yimeng, Wang Jinfeng, Zhang Dong, Niu Hongbo, Jiang Shouwen, Wang Jian, Zhang Dongsheng, Han Bingshe, Xu Qianghua, Chen Liangbiao", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "reference": [ { "type": "PubMed", "id": "27356472", "url": "https://glygen.org/publication/PubMed/27356472" } ] }, { "title": "Edwardsiella tarda-Induced Inhibition of Apoptosis: A Strategy for Intracellular Survival.", "journal": "Front. Cell. Infect. Microbiol.", "date": "2016", "authors": "Zhou Ze-Jun, Sun Li", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "reference": [ { "type": "PubMed", "id": "27471679", "url": "https://glygen.org/publication/PubMed/27471679" } ] }, { "title": "Zebrafish Model for Functional Screening of Flow-Responsive Genes.", "journal": "Arterioscler. Thromb. Vasc. Biol.", "date": "2017", "authors": "Serbanovic-Canic Jovana, de Luca Amalia, Warboys Christina, Ferreira Pedro F, Luong Le A, Hsiao Sarah, Gauci Ismael, Mahmoud Marwa, Feng Shuang, Souilhol Celine, Bowden Neil, Ashton John-Paul, Walczak Henning, Firmin David, Krams Rob, Mason Justin C, Haskard Dorian O, Sherwin Spencer, Ridger Victoria, Chico Timothy J A, Evans Paul C", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "reference": [ { "type": "PubMed", "id": "27834691", "url": "https://glygen.org/publication/PubMed/27834691" } ] }, { "title": "Nucleoporin 62-Like Protein is Required for the Development of Pharyngeal Arches through Regulation of Wnt/beta-Catenin Signaling and Apoptotic Homeostasis in Zebrafish.", "journal": "Cells", "date": "2019", "authors": "Yang Xiaojie, Li Xixi, Gu Qilin, Li Qing, Cui Zongbin", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "reference": [ { "type": "PubMed", "id": "31492028", "url": "https://glygen.org/publication/PubMed/31492028" } ] }, { "title": "Isoliquiritin exert protective effect on telencephalon infarction injury by regulating multi-pathways in zebrafish model of ischemic stroke.", "journal": "Phytomedicine", "date": "2021", "authors": "Zhang Xiao-Huan, Zhou Chen-Cong, Li Chong-Yong, Hua Yao, Li Kang, Wei Ping, He Ming-Fang", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "reference": [ { "type": "PubMed", "id": "33535128", "url": "https://glygen.org/publication/PubMed/33535128" } ] } ], "pathway": [ { "id": "dre:562317", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:562317", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "F1NKQ7-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MDPFLALLNSLSASLSSSELCELKFLCKDKIGKRKLESVQSGRELFNFLMEQQLIASYNVDLLKSMFKTIKREDLISQLEEFIEEGEASAPDERPDMKERRLQKVVIEVICENVGRDWKMLMRKLDFSDVRMERIMVAKPNNLREQLFQSLREWQKWKGKDAKVADLIKALRDCNMNLVADIAEQKLFHLNTENM", "length": 195 }, "evidence": [ { "id": "A0A0R4IXF0", "url": "https://omabrowser.org/oma/group/A0A0R4IXF0/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "G3HQ71-1", "protein_name": "FAS-associated death domain protein", "gene_name": "Fadd", "tax_id": 10029, "organism": "Cricetulus griseus", "sequence": { "sequence": "MDPFLVLLHSVSGNLSSSDLLELKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERTRTGLLRELLASLRRHDLLQRLDDFEAGTAASAAPGEADLRVAFDIVCDNVGRDWKRLARQLKVSEAKIDGIEERYPRSLSEQVREALRVWKIAEREKATVAGLVKALRACRLNLVADLVEEALQAQGSVNENEGISPMLWDPTVSSSEAP", "length": 208 }, "evidence": [ { "id": "A0A0R4IXF0", "url": "https://omabrowser.org/oma/group/A0A0R4IXF0/", "database": "OMA" } ], "glygen_name": "Hamster", "common_name": "Chinese hamster" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS", "length": 208 }, "evidence": [ { "id": "MGI:109324", "url": "https://alliancegenome.org/gene/MGI:109324#orthology", "database": "AGR" }, { "id": "HGNC:3573", "url": "https://alliancegenome.org/gene/HGNC:3573#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-070606-3", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070606-3#orthology", "database": "AGR" }, { "id": "A0A0R4IXF0", "url": "https://omabrowser.org/oma/group/A0A0R4IXF0/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q56VC2-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MDPFLVLLHSVSASLSSSELTELKFLCQGRVGKRKLERVQSGVDLFSVLLEQNELSPEHTALLRELLVSLRRQDLLRRLDAFEAGAAGGAAPEERDLRAAFDIICDNVGKDWRRLARQLKVSDAKIDAIEEKYPRNLTEQVRESLRVWKNSRREDAAVSHLVDALRACRLNLVADLVEEEQQARASRRESGSSDPVSLISWDEDVPGSGAS", "length": 211 }, "evidence": [ { "id": "A0A0R4IXF0", "url": "https://omabrowser.org/oma/group/A0A0R4IXF0/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q61160-1", "protein_name": "FAS-associated death domain protein", "gene_name": "Fadd", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDPFLVLLHSLSGSLSGNDLMELKFLCRERVSKRKLERVQSGLDLFTVLLEQNDLERGHTGLLRELLASLRRHDLLQRLDDFEAGTATAAPPGEADLQVAFDIVCDNVGRDWKRLARELKVSEAKMDGIEEKYPRSLSERVRESLKVWKNAEKKNASVAGLVKALRTCRLNLVADLVEEAQESVSKSENMSPVLRDSTVSSSETP", "length": 205 }, "evidence": [ { "id": "MGI:109324", "url": "https://alliancegenome.org/gene/MGI:109324#orthology", "database": "AGR" }, { "id": "HGNC:3573", "url": "https://alliancegenome.org/gene/HGNC:3573#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-070606-3", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070606-3#orthology", "database": "AGR" }, { "id": "A0A0R4IXF0", "url": "https://omabrowser.org/oma/group/A0A0R4IXF0/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q645M6-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MDPFLVLLHSVSAGLSSSDLTQLKFLCQNHISKRKLELAQSGLDLFTVLLQQNELNAEHTALLRELLCSLRRKDLLLRLDDFERGAAGGAAPEDRDLRAAMEIICDNVGKDWRRLARHLGVSDVKIEAIEEKYPRNLAEQVRELLRVWKNSTRENAAVSCLVGALRGCQLNVVADLIEEDQRARALQSGSANPGSFTAWDSGSAAPGAS", "length": 209 }, "evidence": [ { "id": "A0A0R4IXF0", "url": "https://omabrowser.org/oma/group/A0A0R4IXF0/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q8R2E7-1", "protein_name": "FAS-associated death domain protein", "gene_name": "Fadd", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDPFLVLLHSLSSSLSGNDLTDLKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERGHTGLLRELLASLGRHDLLQRLDDFEAGATTAATPGEADLRVAFDIVCDNVGRDWKRLARELKVSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENASVAGLVKALRACRLNLVADLVEEALMAQGSVSKSDDTSSALRDSTVSFSETP", "length": 208 }, "evidence": [ { "id": "MGI:109324", "url": "https://alliancegenome.org/gene/MGI:109324#orthology", "database": "AGR" }, { "id": "HGNC:3573", "url": "https://alliancegenome.org/gene/HGNC:3573#orthology", "database": "AGR" }, { "id": "A0A0R4IXF0", "url": "https://omabrowser.org/oma/group/A0A0R4IXF0/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9V3B4-1", "protein_name": "Fas-associated death domain protein", "gene_name": "Fadd", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MTAGRHWSYDSLKQIAIDGCTENVEQLKLIFVEEIGSRRRSDCIRTIEDLIDCLERADELSEYNVEPLRRISGNMPQLIEALSAYTKPENILGHPVNLYQELRLAEELRQQLRIAPASQNAQPSVSELAAAVPPTAIQNYATPAAFTDHKRTMVFKKISEELGRYWRRLGRSAGIGEGQMDTIEERYPHDLKSQILRLLQLIEEDDCHDPKHFLLRLCRALGDCGRNDLRKRVEQIMSH", "length": 239 }, "evidence": [ { "id": "MGI:109324", "url": "https://alliancegenome.org/gene/MGI:109324#orthology", "database": "AGR" }, { "id": "HGNC:3573", "url": "https://alliancegenome.org/gene/HGNC:3573#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway", "id": "GO:0097191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097191", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "pmid": "" }, { "name": "positive regulation of innate immune response", "id": "GO:0045089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045089", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "CD95 death-inducing signaling complex", "id": "GO:0031265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031265", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "caspase binding", "id": "GO:0089720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0089720", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "pmid": "" }, { "name": "death receptor binding", "id": "GO:0005123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005123", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXF0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXF0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 179, "end_pos": 181, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 179, "end_pos": 181 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }