{ "uniprot_canonical_ac": "A0A0R4IXA2-1", "uniprot_ac": "A0A0R4IXA2", "uniprot_id": "A0A0R4IXA2_DANRE", "mass": { "chemical_mass": 41400.0, "monoisotopic_mass": 41400.0 }, "refseq": { "ac": "NP_001074456", "name": "cellular communication network factor 1, like 2 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074456" }, "gene_names": [ { "name": "ccn1l2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2", "id": "A0A0R4IXA2" }, { "name": "ccn1l2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074456", "id": "NP_001074456" }, { "name": "cyr61-l2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2", "id": "A0A0R4IXA2" }, { "name": "cyr61; cyr61-l2; cyr61l2; zCyr61-c8; zgc:158158", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074456", "id": "NP_001074456" }, { "name": "cyr61l2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2", "id": "A0A0R4IXA2" }, { "name": "cyr61", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2", "id": "A0A0R4IXA2" }, { "name": "zCyr61-c8", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2", "id": "A0A0R4IXA2" }, { "name": "zgc:158158", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2", "id": "A0A0R4IXA2" } ], "protein_names": [ { "name": "Cellular communication network factor 1, like 2 precursor", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2/entry#names_and_taxonomy", "id": "A0A0R4IXA2" }, { "name": "Cellular communication network factor 1,-like 2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2/entry#names_and_taxonomy", "id": "A0A0R4IXA2" }, { "name": "cellular communication network factor 1, like 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074456", "id": "NP_001074456" }, { "name": "cysteine-rich, angiogenic inducer, 61 like 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074456", "id": "NP_001074456" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: SRR26395012.1175148.1, SRR26395013.67090.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505379 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JBMGRA010000008.1. On or before Jan 5, 2017 this sequence version replaced XP_017212820.1, NP_001074456.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.", "evidence": [ { "database": "RefSeq", "id": "NP_001074456", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074456" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "ccn1l2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-060404-5", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-060404-5", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000099985", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000099985", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "553273", "url": "https://www.ncbi.nlm.nih.gov/gene/553273", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000867", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000867", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000884", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000884", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001007", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001007", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006207", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006207", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006208", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006208", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036383", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036383", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043973", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043973", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050941", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050941", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:553273", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:553273", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "EDFQPNC", "url": "https://omabrowser.org/oma/group/EDFQPNC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IXA2", "url": "https://www.orthodb.org/?gene=A0A0R4IXA2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11348", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11348", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11348:SF33", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11348:SF33", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00007", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00007", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00093", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00093", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00219", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00219", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF19035", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF19035", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001074456", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074456", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IXA2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-060404-5", "url": "https://zfin.org/ZDB-GENE-060404-5", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MHSGRNQRTRTHTWVVLLFVVCSADGEVSRGCPGPCSCPPSPPSCPRGVSRVWDNCGCCKVCAQQFNQDCGSDLPCDHIKGLHCHLGAGGDPQRGLCRAEAHGRPCEFSGRVYQHGEDFQTGCEHQCSCIDGVVGCVPLCPLLVPLPGSHCTNPRLETPTGHCCQRWVCDSDNSIREEEPLPKHTPQYNHISKLLQEHRSRPAAQEWSSAPVSEIPFPSPGCFSQTTDWSECSASCGFGVSSRVTNSNAQCRLIRETRLCQITPCDATPHLKKGKKCRRTTRPRKPELITFAGCSTVRRYRPRSCGSCVDDRCCQPRSTRTVRMRFRCPDGENITRSVMWIQTCRCSKSFCRAKRGRSSPAVSLHNDIHTFTH", "length": 373, "header": "tr|A0A0R4IXA2-1|A0A0R4IXA2_DANRE Isoform 1 of Cellular communication network factor 1,-like 2 OS=Danio rerio OX=7955 GN=ccn1l2 PE=3 SV=1 CANONICAL=A0A0R4IXA2-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IXA2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2/entry#A0A0R4IXA2-1", "sequence": { "sequence": "MHSGRNQRTRTHTWVVLLFVVCSADGEVSRGCPGPCSCPPSPPSCPRGVSRVWDNCGCCKVCAQQFNQDCGSDLPCDHIKGLHCHLGAGGDPQRGLCRAEAHGRPCEFSGRVYQHGEDFQTGCEHQCSCIDGVVGCVPLCPLLVPLPGSHCTNPRLETPTGHCCQRWVCDSDNSIREEEPLPKHTPQYNHISKLLQEHRSRPAAQEWSSAPVSEIPFPSPGCFSQTTDWSECSASCGFGVSSRVTNSNAQCRLIRETRLCQITPCDATPHLKKGKKCRRTTRPRKPELITFAGCSTVRRYRPRSCGSCVDDRCCQPRSTRTVRMRFRCPDGENITRSVMWIQTCRCSKSFCRAKRGRSSPAVSLHNDIHTFTH", "length": 373, "header": "tr|A0A0R4IXA2-1|A0A0R4IXA2_DANRE Isoform 1 of Cellular communication network factor 1,-like 2 OS=Danio rerio OX=7955 GN=ccn1l2 PE=3 SV=1 CANONICAL=A0A0R4IXA2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Gene duplication, gene loss and evolution of expression domains in the vertebrate nuclear receptor NR5A (Ftz-F1) family.", "journal": "Biochem. J.", "date": "2005", "authors": "Kuo Ming-Wei, Postlethwait John, Lee Wen-Chih, Lou Show-Wan, Chan Woon-Khiong, Chung Bon-chu", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "15725073", "url": "https://glygen.org/publication/PubMed/15725073" } ] }, { "title": "Temporal and spatial expression of CCN genes in zebrafish.", "journal": "Dev. Dyn.", "date": "2010", "authors": "Fernando Carol A, Conrad Patricia A, Bartels Cynthia F, Marques Tomas, To Michael, Balow Stephanie A, Nakamura Yukio, Warman Matthew L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "20503371", "url": "https://glygen.org/publication/PubMed/20503371" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Transcriptome alterations in zebrafish embryos after exposure to environmental estrogens and anti-androgens can reveal endocrine disruption.", "journal": "Reprod. Toxicol.", "date": "2013", "authors": "Schiller Viktoria, Wichmann Arne, Kriehuber Ralf, Sch\u00e4fers Christoph, Fischer Rainer, Fenske Martina", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "24051129", "url": "https://glygen.org/publication/PubMed/24051129" } ] }, { "title": "Activity of binary mixtures of drospirenone with progesterone and 17alpha-ethinylestradiol in vitro and in vivo.", "journal": "Aquat. Toxicol.", "date": "2016", "authors": "Rossier Nadine Madeleine, Chew Geraldine, Zhang Kun, Riva Francesco, Fent Karl", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "26930480", "url": "https://glygen.org/publication/PubMed/26930480" } ] }, { "title": "Linking the response of endocrine regulated genes to adverse effects on sex differentiation improves comprehension of aromatase inhibition in a Fish Sexual Development Test.", "journal": "Aquat. Toxicol.", "date": "2016", "authors": "Muth-K\u00f6hne Elke, Westphal-Settele Kathi, Br\u00fcckner Jasmin, Konradi Sabine, Schiller Viktoria, Sch\u00e4fers Christoph, Teigeler Matthias, Fenske Martina", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "27130971", "url": "https://glygen.org/publication/PubMed/27130971" } ] }, { "title": "Gene evolution and gene expression after whole genome duplication in fish: the PhyloFish database.", "journal": "BMC Genomics", "date": "2016", "authors": "Pasquier Jeremy, Cabau C\u00e9dric, Nguyen Thaovi, Jouanno Elodie, Severac Dany, Braasch Ingo, Journot Laurent, Pontarotti Pierre, Klopp Christophe, Postlethwait John H, Guiguen Yann, Bobe Julien", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "27189481", "url": "https://glygen.org/publication/PubMed/27189481" } ] }, { "title": "Yap reprograms glutamine metabolism to increase nucleotide biosynthesis and enable liver growth.", "journal": "Nat. Cell Biol.", "date": "2016", "authors": "Cox Andrew G, Hwang Katie L, Brown Kristin K, Evason Kimberley, Beltz Sebastian, Tsomides Allison, O'Connor Keelin, Galli Giorgio G, Yimlamai Dean, Chhangawala Sagar, Yuan Min, Lien Evan C, Wucherpfennig Julia, Nissim Sahar, Minami Akihiro, Cohen David E, Camargo Fernando D, Asara John M, Houvras Yariv, Stainier Didier Y R, Goessling Wolfram", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "27428308", "url": "https://glygen.org/publication/PubMed/27428308" } ] }, { "title": "Yap regulates glucose utilization and sustains nucleotide synthesis to enable organ growth.", "journal": "EMBO J.", "date": "2018", "authors": "Cox Andrew G, Tsomides Allison, Yimlamai Dean, Hwang Katie L, Miesfeld Joel, Galli Giorgio G, Fowl Brendan H, Fort Michael, Ma Kimberly Y, Sullivan Mark R, Hosios Aaron M, Snay Erin, Yuan Min, Brown Kristin K, Lien Evan C, Chhangawala Sagar, Steinhauser Matthew L, Asara John M, Houvras Yariv, Link Brian, Vander Heiden Matthew G, Camargo Fernando D, Goessling Wolfram", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "30348863", "url": "https://glygen.org/publication/PubMed/30348863" } ] }, { "title": "CCN1 interlinks integrin and hippo pathway to autoregulate tip cell activity.", "journal": "Elife", "date": "2019", "authors": "Park MH, Kim AK, Manandhar S, Oh SY, Jang GH, Kang L, Lee DW, Hyeon DY, Lee SH, Lee HE, Huh TL, Suh SH, Hwang D, Byun K, Park HC, Lee YM", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "31429823", "url": "https://glygen.org/publication/PubMed/31429823" } ] }, { "title": "Glia maturation factor-gamma is required for initiation and maintenance of hematopoietic stem and progenitor cells.", "journal": "Stem Cell Res Ther", "date": "2023", "authors": "Li Honghu, Luo Qian, Cai Shuyang, Tie Ruxiu, Meng Ye, Shan Wei, Xu Yulin, Zeng Xiangjun, Qian Pengxu, Huang He", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "reference": [ { "type": "PubMed", "id": "37122014", "url": "https://glygen.org/publication/PubMed/37122014" } ] } ], "pathway": [ { "id": "dre:553273", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:553273", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "pmid": "" }, { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "pmid": "" }, { "name": "positive regulation of cell differentiation", "id": "GO:0045597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045597", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IXA2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IXA2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 333, "end_pos": 335, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 333, "end_pos": 335 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }