{ "uniprot_canonical_ac": "A0A0R4IVX5-1", "uniprot_ac": "A0A0R4IVX5", "uniprot_id": "A0A0R4IVX5_DANRE", "mass": { "chemical_mass": 32193.0, "monoisotopic_mass": 32193.0 }, "refseq": {}, "gene_names": [ { "name": "jazf1a", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5", "id": "A0A0R4IVX5" }, { "name": "si:ch211-204j16.1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5", "id": "A0A0R4IVX5" } ], "protein_names": [ { "name": "Juxtaposed with another zinc finger protein 1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5/entry#names_and_taxonomy", "id": "A0A0R4IVX5" } ], "function": [ { "annotation": "Acts as a transcriptional corepressor of orphan nuclear receptor NR2C2. Inhibits expression of the gluconeogenesis enzyme PCK2 through inhibition of NR2C2 activity. Also involved in transcriptional activation of NAMPT by promoting expression of PPARA and PPARD. Plays a role in lipid metabolism by suppressing lipogenesis, increasing lipolysis and decreasing lipid accumulation in adipose tissue. Plays a role in glucose homeostasis by improving glucose metabolism and insulin sensitivity.", "evidence": [ { "database": "UniProtKB", "id": "A0A8M1N9M9", "url": "https://www.uniprot.org/uniprotkb/A0A8M1N9M9#function" }, { "database": "UniProtKB", "id": "ARBA00054131", "url": "https://www.uniprot.org/uniprotkb/ARBA00054131#function" }, { "database": "UniProtKB", "id": "A0A0R4IVX5", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IVX5", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "jazf1a", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-060503-492", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-060503-492", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000102551", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000102551", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "561144", "url": "https://www.ncbi.nlm.nih.gov/gene/561144", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051580", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051580", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:561144", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:561144", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QPACIPL", "url": "https://omabrowser.org/oma/group/QPACIPL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IVX5", "url": "https://www.orthodb.org/?gene=A0A0R4IVX5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A8M1N9M9", "url": "https://www.orthodb.org/?gene=A0A8M1N9M9", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23057", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23057", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23057:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23057:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "XP_005159575", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005159575", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IVX5", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IVX5-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M1N9M9", "url": "https://www.uniprot.org/uniprotkb/A0A8M1N9M9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M1N9M9-1", "url": "https://www.uniprot.org/uniprotkb/A0A8M1N9M9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-060503-492", "url": "https://zfin.org/ZDB-GENE-060503-492", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MPLCPHPPPIGCQPSKQLQLQSPPPLLLQRAAGYLITPIPHSLCLHWSANARTSANTSIMTGVAAASFFSNVCRFGGCGLHFESLGELIVHIEDNHIDTDPRVLERQELQQPTYVALSYINRFMTEAARREQETQKKKVQPKIAISVTGGVSRNSTATPPRHSNGSLTPPVTPPITPSSSFRSSTPTGSECDEEEVEYEDSDSDESWTTESAISSESILSSMCMNGGDEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTSQGLRHHTINFHPPL", "length": 292, "header": "tr|A0A0R4IVX5-1|A0A0R4IVX5_DANRE Isoform 1 of Juxtaposed with another zinc finger protein 1 OS=Danio rerio OX=7955 GN=jazf1a PE=4 SV=1 CANONICAL=A0A0R4IVX5-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IVX5-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5/entry#A0A0R4IVX5-1", "sequence": { "sequence": "MPLCPHPPPIGCQPSKQLQLQSPPPLLLQRAAGYLITPIPHSLCLHWSANARTSANTSIMTGVAAASFFSNVCRFGGCGLHFESLGELIVHIEDNHIDTDPRVLERQELQQPTYVALSYINRFMTEAARREQETQKKKVQPKIAISVTGGVSRNSTATPPRHSNGSLTPPVTPPITPSSSFRSSTPTGSECDEEEVEYEDSDSDESWTTESAISSESILSSMCMNGGDEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTSQGLRHHTINFHPPL", "length": 292, "header": "tr|A0A0R4IVX5-1|A0A0R4IVX5_DANRE Isoform 1 of Juxtaposed with another zinc finger protein 1 OS=Danio rerio OX=7955 GN=jazf1a PE=4 SV=1 CANONICAL=A0A0R4IVX5-1" }, "locus": {} }, { "isoform_ac": "A0A8M1N9M9-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5/entry#A0A8M1N9M9-1", "sequence": { "sequence": "MTGVAAASFFSNVCRFGGCGLHFESLGELIVHIEDNHTDPRVLERQELQQPTYVALSYINRFMTEAARREQETQKKKVQPKIAISVTGGVSRNSTATPPRHSNGSLTPPVTPPITPSSSFRSSTPTGSECDEEEVEYEDSDSDESWTTESAISSESILSSMCMNGGDEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTSQGLRHHTINFHPPL", "length": 231, "header": "tr|A0A8M1N9M9-1|A0A0R4IVX5_DANRE Computationally mapped isoform of Juxtaposed with another zinc finger protein 1 OS=Danio rerio OX=7955 GN=jazf1a PE=4 SV=1 CANONICAL=A0A0R4IVX5-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 158, "start_aa": "Thr", "end_pos": 158, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr158", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ], "filter_code": "00000000000000001000.00000000001000.0.xxxxx" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 172, "start_aa": "Thr", "end_pos": 172, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr172", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ], "filter_code": "00000000000000001000.00000000001000.0.xxxxx" } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A8M1N9M9", "url": "https://www.uniprot.org/uniprotkb/A0A8M1N9M9" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Gene evolution and gene expression after whole genome duplication in fish: the PhyloFish database.", "journal": "BMC Genomics", "date": "2016", "authors": "Pasquier Jeremy, Cabau C\u00e9dric, Nguyen Thaovi, Jouanno Elodie, Severac Dany, Braasch Ingo, Journot Laurent, Pontarotti Pierre, Klopp Christophe, Postlethwait John H, Guiguen Yann, Bobe Julien", "evidence": [ { "database": "UniProtKB", "id": "A0A8M1N9M9", "url": "https://www.uniprot.org/uniprotkb/A0A8M1N9M9" } ], "reference": [ { "type": "PubMed", "id": "27189481", "url": "https://glygen.org/publication/PubMed/27189481" } ] } ], "pathway": [ { "id": "dre:561144", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:561144", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZA80-1", "protein_name": "Juxtaposed with another zinc finger protein 1", "gene_name": "Jazf1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEMIRKMQQ", "length": 243 }, "evidence": [ { "id": "HGNC:28917", "url": "https://alliancegenome.org/gene/HGNC:28917#orthology", "database": "AGR" }, { "id": "MGI:2141450", "url": "https://alliancegenome.org/gene/MGI:2141450#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P32432-1", "protein_name": "Transcription factor SFP1", "gene_name": "SFP1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MDFTTMTMASNMATSTTTTATSAHASINSSSNFNIDIDSNQNTPSILINNNSDSSNGKNTDFNGVNNIHQKNIMNNTNNVHLYSPNIMDQTLLTPQDIAKLRRESIAHSQGMGGVSWGSISVGSWLRDEIISRRNSIVPASANGAASAAASATTTATNTLQIQQPTKRPSVSNPPYHRGYSISPQIAYTAYLPNLEKQYCKDYSCCGLSLPGLHDLLRHYEEAHISTSPNTTNMSQIPMNSAGNTSSSVRMTNNTSSANYNLQNNMAANTKNAGHKTNTMQAHSSNATNNTSINNMHANLQSNMDSNSTIRQSQHPHHQQNIIQQQLQSNSVNHTSGAVPTPSVMGSATASSTTANPNVISITGAPNSGLSMANHSQQLHLNGNLVDAVSTNDVFLRTSNSPSRHVPHNKQINSNNNSGININNNTSHNSNINMGSKNAMVNRPHTFNNYSLNKTSRNPIQHQSRKIDPHQTDLSPLVLVQDIDLSFMDDDILGPSNHNSMNSVVNPTTGSHNYNTFHSSVHAKSSQNMVEDQDIDDIDDDDDVDDDDDDDDDDDTENGSSSNGKSVHNNNYKMPQQAYIDDPARRLYVMDHEEQKPFKCPVIGCEKTYKNQNGLKYHRLHGHQNQKLHENPDGTFSVIDPDSTDSFGDGMGSAKDKPYRCEVCGKRYKNLNGLKYHRGHSTH", "length": 683 }, "evidence": [ { "id": "HGNC:28917", "url": "https://alliancegenome.org/gene/HGNC:28917#orthology", "database": "AGR" }, { "id": "MGI:2141450", "url": "https://alliancegenome.org/gene/MGI:2141450#orthology", "database": "AGR" } ], "glygen_name": "Yeast", "common_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q49TU3-1", "protein_name": "Juxtaposed with another zinc finger protein 1", "gene_name": "jazf1b", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MTGIAAASFFSNICQFGGCGLHFESLAELIVHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREHESLKKKVQPKLSLSLMGSLSRSSVATPPRHNSGNLTPPVTPPITPSSSFRSSTPTGSEYDEEEAEYEESDSDESWTTESAISSEYILSSMCMNGGDEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKSSQGLRHHTINFHPPVSAEIIRKLQQ", "length": 243 }, "evidence": [ { "id": "HGNC:28917", "url": "https://alliancegenome.org/gene/HGNC:28917#orthology", "database": "AGR" }, { "id": "MGI:2141450", "url": "https://alliancegenome.org/gene/MGI:2141450#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q80ZQ5-1", "protein_name": "Juxtaposed with another zinc finger protein 1", "gene_name": "Jazf1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEMIRKMQQ", "length": 243 }, "evidence": [ { "id": "HGNC:28917", "url": "https://alliancegenome.org/gene/HGNC:28917#orthology", "database": "AGR" }, { "id": "MGI:2141450", "url": "https://alliancegenome.org/gene/MGI:2141450#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-060503-492", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-060503-492#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q86VZ6-1", "protein_name": "Juxtaposed with another zinc finger protein 1", "gene_name": "JAZF1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ", "length": 243 }, "evidence": [ { "id": "HGNC:28917", "url": "https://alliancegenome.org/gene/HGNC:28917#orthology", "database": "AGR" }, { "id": "MGI:2141450", "url": "https://alliancegenome.org/gene/MGI:2141450#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-060503-492", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-060503-492#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9V9Z6-1", "protein_name": "Uncharacterized protein, isoform A", "gene_name": "Dmel\\CG12054", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MAVFLINVCKYNGCGITFPSLSDLISHIEDTHIDYDPKVVEQKEQAQPACLPLSYVLRFITEENRKEAGSFLASNTTAPPTTNSGSNAAGHGNGNVELKRKLAIKHHSYSMSSSNRSTTPTGSEMDEDEMVVTESEDSNDSWTTEEFSSEFIMRYGSRHSGGGSNGTPGNEKPFACPVPGCKKRYKNVNGIKYHSKNGHKKDGRVRKGYKCHCGKSYKTAQGLKNHALHTHNSQPDSVLNAQLANALAIGDGASAATPVGSSNTSSNPNPPPIIQRSNSPSQSLGSLSPSSISNMSSSASSCHGGSGSLSNGNNGNNGSTTSNTAILTSNGNVLQQLSAGNVVTLTNLPTQQHQQQQPQPQQQQQQQLHQNTATGNSNNNNLMRSTLGLVSIKTNNTPTAKSVSNLMAANATASKILKLATNVANGGSSMDIVQQQQQHNKTTTTGQTVLNGSKPLPNLVNLGILTPATSPTKNTQTLTFTTTNGSTQQQQALVASLSKKTNILLLQEPTQLVQQVQQQQQQQQQQQQQLQQQVQQQHHVLPISPTSSVSGNSSKSSSPTPQQQQQQLLKKGKLELIEPMETDEGQSDGISESVAAAIASITDCKEDIGGATVAGIEVVGAGAVNEET", "length": 628 }, "evidence": [ { "id": "HGNC:28917", "url": "https://alliancegenome.org/gene/HGNC:28917#orthology", "database": "AGR" }, { "id": "MGI:2141450", "url": "https://alliancegenome.org/gene/MGI:2141450#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IVX5", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IVX5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 154, "end_pos": 156, "annotation": "n_glycosylation_sequon" }, { "start_pos": 164, "end_pos": 166, "annotation": "n_glycosylation_sequon" }, { "start_pos": 56, "end_pos": 58, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 158, 172 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 154, "end_pos": 156 }, { "start_pos": 164, "end_pos": 166 }, { "start_pos": 56, "end_pos": 58 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }