{ "uniprot_canonical_ac": "A0A0R4ITP2-1", "uniprot_ac": "A0A0R4ITP2", "uniprot_id": "A0A0R4ITP2_DANRE", "mass": { "chemical_mass": 35180.0, "monoisotopic_mass": 35180.0 }, "refseq": { "ac": "NP_001307461", "name": "ataxin-3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307461" }, "gene_names": [ { "name": "atxn3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2", "id": "A0A0R4ITP2" }, { "name": "Mjd; zgc:56323", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307461", "id": "NP_001307461" }, { "name": "Mjd", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2", "id": "A0A0R4ITP2" }, { "name": "atxn3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307461", "id": "NP_001307461" }, { "name": "zgc:56323", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2", "id": "A0A0R4ITP2" } ], "protein_names": [ { "name": "ubiquitinyl hydrolase 1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2/entry#names_and_taxonomy", "id": "A0A0R4ITP2" }, { "name": "3.4.19.12", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2/entry#names_and_taxonomy", "id": "A0A0R4ITP2" }, { "name": "ataxin-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307461", "id": "NP_001307461" } ], "function": [ { "annotation": "##Evidence-Data-START## RNAseq introns :: partial sample support SAMEA3505370, SAMEA3505371 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## inferred exon combination :: based on alignments, homology ##RefSeq-Attributes-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JBMGRA010000017.1. On Jun 25, 2025 this sequence version replaced NP_001307461.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.", "evidence": [ { "database": "RefSeq", "id": "NP_001307461", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307461" } ] } ], "disease": [ { "disease_id": "DOID:0060892", "recommended_name": { "id": "DOID:0060892", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060892", "name": "late onset Parkinson's disease", "description": "A Parkinson's disease characterized by onset of motor symptoms typically after 60 years of age." }, "synonyms": [ { "id": "DOID:0060892", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060892", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "A Parkinson disease that begins after around the age of 50." }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "LOPD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PARK", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, age of onset, modifier, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "autosomal dominant late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson's disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "" }, { "id": "MIM:168600", "resource": "MIM", "url": "https://www.omim.org/entry/168600", "name": "Parkinson disease", "description": "Parkinson disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0060892", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060892" } ] }, { "disease_id": "DOID:1440", "recommended_name": { "id": "DOID:1440", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1440", "name": "Machado-Joseph disease", "description": "An autosomal dominant cerebellar ataxia that is characterized by slow degeneration of the hindbrain and has_material_basis_in expansion of CAG triplet repeats (glutamine) in the ATXN3 gene." }, "synonyms": [ { "id": "DOID:1440", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1440", "name": "Azorean disease", "description": "" }, { "id": "DOID:1440", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1440", "name": "MJD", "description": "" }, { "id": "DOID:1440", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1440", "name": "SCA3", "description": "" }, { "id": "DOID:1440", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1440", "name": "spinocerebellar ataxia 3", "description": "" }, { "id": "DOID:1440", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1440", "name": "spinocerebellar ataxia type 3", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "Machado-Joseph disease", "description": "Spinocerebellar ataxia type 3 (SCA3), also known as Machado-Joseph disease, is the most common subtype of type 1 autosomal dominant cerebellar ataxia (ADCA type 1), a neurodegenerative disorder, and is characterized by ataxia, external progressive ophthalmoplegia, and other neurological manifestations." }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "Azorean disease", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "Azorean disease of the nervous system", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "MJD", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "Machado disease", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "Machado-Joseph disease", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "Nigro-spino-dentatal degeneration with nuclear ophthalmoplegia", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "SCA3", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "autosomal dominant striatonigral degeneration", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "spinocerebellar ataxia 3", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "spinocerebellar ataxia type 3", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "Azorean neurologic disease", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "Nigrospinodentatal Degeneration", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "Spinopontine atrophy", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "spinocerebellar atrophy 3", "description": "" }, { "id": "MONDO:0007182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007182", "name": "spinocerebellar atrophy type 3", "description": "" }, { "id": "MIM:109150", "resource": "MIM", "url": "https://www.omim.org/entry/109150", "name": "Spinocerebellar ataxia 3", "description": "Spinocerebellar ataxia 3" } ], "unlinked_id_list": [], "evidence": [ { "id": "1440", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1440" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "atxn3", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-040426-983", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040426-983", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000099274", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000099274", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "394079", "url": "https://www.ncbi.nlm.nih.gov/gene/394079", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003903", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003903", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006155", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006155", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033865", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033865", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:394079", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:394079", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LGQAYIC", "url": "https://omabrowser.org/oma/group/LGQAYIC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4ITP2", "url": "https://www.orthodb.org/?gene=A0A0R4ITP2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14159", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14159", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14159:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14159:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02099", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02099", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02809", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02809", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001307461", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307461", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4ITP2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M9P030", "url": "https://www.uniprot.org/uniprotkb/A0A8M9P030", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M9P030-1", "url": "https://www.uniprot.org/uniprotkb/A0A8M9P030-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-040426-983", "url": "https://zfin.org/ZDB-GENE-040426-983", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAQQLDEEERMRMAEGGVQTEEYRTFLQQPSGNMDDSGFFSIQVISNALGVWGLEIVLFNSREYQQLQMDPMHEKAFICNYKEHWFTVRKLGQQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVIRGNLPECEADQILRIMRVEQQQRPKLIGEEEAQRMSAPHASETTHTAEEPVLDEDEEELRKALALSRQDLQVEDEEADLRRAIQMSMQGSSDAGSSAPAGGSSEKQTLSAEELRRRRQAYFDRQQNAQDSSSSTGGGTDSGPKPTQ", "length": 311, "header": "tr|A0A0R4ITP2-1|A0A0R4ITP2_DANRE Isoform 1 of ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=atxn3 PE=1 SV=2 CANONICAL=A0A0R4ITP2-1" }, "isoforms": [ { "isoform_ac": "A0A0R4ITP2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2/entry#A0A0R4ITP2-1", "sequence": { "sequence": "MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAQQLDEEERMRMAEGGVQTEEYRTFLQQPSGNMDDSGFFSIQVISNALGVWGLEIVLFNSREYQQLQMDPMHEKAFICNYKEHWFTVRKLGQQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVIRGNLPECEADQILRIMRVEQQQRPKLIGEEEAQRMSAPHASETTHTAEEPVLDEDEEELRKALALSRQDLQVEDEEADLRRAIQMSMQGSSDAGSSAPAGGSSEKQTLSAEELRRRRQAYFDRQQNAQDSSSSTGGGTDSGPKPTQ", "length": 311, "header": "tr|A0A0R4ITP2-1|A0A0R4ITP2_DANRE Isoform 1 of ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=atxn3 PE=1 SV=2 CANONICAL=A0A0R4ITP2-1" }, "locus": {} }, { "isoform_ac": "A0A8M9P030-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2/entry#A0A8M9P030-1", "sequence": { "sequence": "MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAQQLDEEERMRMAEGGVQTEEYRTFLQPSGNMDDSGFFSIQVISNALGVWGLEIVLFNSREYQQLQMDPMHEKAFICNYKEHWFTVRKLGQQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVIRGNLPECEADQILRIMRVEQQQRPKLIGEEEAQRMSAPHASETTHTAEEPVLDEDEEELRKALALSRQDLQVEDEEADLRRAIQMSMQGSSDAGSSAPAGGSSEKQTLSAEELRRRRQAYFDRQQNAQDSSSSTGGGTDSGPKPTQ", "length": 310, "header": "tr|A0A8M9P030-1|A0A8M9P030_DANRE Computationally mapped isoform of ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=atxn3 PE=1 SV=1 CANONICAL=A0A0R4ITP2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Genome-wide loss-of-function analysis of deubiquitylating enzymes for zebrafish development.", "journal": "BMC Genomics", "date": "2009", "authors": "Tse William K F, Eisenhaber Birgit, Ho Steven H K, Ng Qimei, Eisenhaber Frank, Jiang Yun-Jin", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "reference": [ { "type": "PubMed", "id": "20040115", "url": "https://glygen.org/publication/PubMed/20040115" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A8M9P030", "url": "https://www.uniprot.org/uniprotkb/A0A8M9P030" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "The Deubiquitinating Enzyme Ataxin-3 Regulates Ciliogenesis and Phagocytosis in the Retina.", "journal": "Cell Rep.", "date": "2020", "authors": "Toulis Vasileios, Garc\u00eda-Moncl\u00fas S\u00edlvia, de la Pe\u00f1a-Ram\u00edrez Carlos, Arenas-Galnares Rodrigo, Abril Josep F, Todi Sokol V, Khan Naheed, Garanto Alejandro, Costa Maria do Carmo, Marfany Gemma", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "reference": [ { "type": "PubMed", "id": "33176149", "url": "https://glygen.org/publication/PubMed/33176149" } ] }, { "title": "Knockdown screening of chromatin binding and regulatory proteins in zebrafish identified Suz12b as a regulator of tfpia and an antithrombotic drug target.", "journal": "Sci. Rep.", "date": "2021", "authors": "Raman Revathi, Fallatah Weam, Al Qaryoute Ayah, Dhinoja Sanchi, Jagadeeswaran Pudur", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "reference": [ { "type": "PubMed", "id": "34315984", "url": "https://glygen.org/publication/PubMed/34315984" } ] } ], "pathway": [ { "id": "dre:394079", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:394079", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O35815-1", "protein_name": "Ataxin-3", "gene_name": "Atxn3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERLRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIKVQQMHRPKLIGEELAHLKEQSALKADLERVLEAADGPGMFDDDEDDLQRALAMSRQEIDMEDEEADLRRAIQLSMQGSSRGMCEDSPQTSSTDLSSEELRKRREAYFEKQQHQQQEADRPGYLSYPCERPTTSSGGLRSNQAGNAMSEEDVLRATVTVSLETAKDSLKAERKK", "length": 355 }, "evidence": [ { "id": "HGNC:7106", "url": "https://alliancegenome.org/gene/HGNC:7106#orthology", "database": "AGR" }, { "id": "A0A0R4ITP2", "url": "https://omabrowser.org/oma/group/A0A0R4ITP2/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P54252-2", "protein_name": "Ataxin-3", "gene_name": "ATXN3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLETVRNDLKTEGKK", "length": 361 }, "evidence": [ { "id": "HGNC:7106", "url": "https://alliancegenome.org/gene/HGNC:7106#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-040426-983", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040426-983#orthology", "database": "AGR" }, { "id": "A0A0R4ITP2", "url": "https://omabrowser.org/oma/group/A0A0R4ITP2/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q06AV3-1", "protein_name": "ubiquitinyl hydrolase 1", "gene_name": "ATXN3", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMQRPKLIGEELAQLKEQRVQKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGTSRNISQDIPQTSGTHLTSEELRKRREAYFEKQQQQQQQDPPGPLTHPCEKPTTSSEALSSELGDAMSEEDMLQAAVTMSLETVRNNFKTEGKK", "length": 353 }, "evidence": [ { "id": "A0A0R4ITP2", "url": "https://omabrowser.org/oma/group/A0A0R4ITP2/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q9CVD2-1", "protein_name": "Ataxin-3", "gene_name": "Atxn3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERLRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIKVQQMHRPKLIGEELAHLKEQSALKADLERVLEAADGSGIFDEDEDDLQRALAISRQEIDMEDEEADLRRAIQLSMQGSSRSMCENSPQTSSPDLSSEELRRRREAYFEKQQQQQQEVDRPGPLSYPRERPTTSSGGRRSDQGGDAVSEEDMLRAAVTMSLETAKDNLKAERKK", "length": 355 }, "evidence": [ { "id": "HGNC:7106", "url": "https://alliancegenome.org/gene/HGNC:7106#orthology", "database": "AGR" }, { "id": "A0A0R4ITP2", "url": "https://omabrowser.org/oma/group/A0A0R4ITP2/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9W689-1", "protein_name": "Ataxin-3", "gene_name": "ATXN3", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MESIFHERQEGSLCAQHCLNNLLQGEYFSPVELSSIAQQLDEEERMRMAEGGVSSEEYRTFLQQPSVNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLGIDPINEKSFICNYKEHWFTVRKLGKQWFNLNSLLMGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQVQRPKLIGEETAQSRDQRLPRSDVDQAIEVSHPFDGTGMLDEDEENFQRALALSRQEIDMEDEEADLRRAIQLSMQGSRQSEFSNSLPQNASQPPHTSQTDSLSSEDLRRRRQAYFEKQQQQLQQQDLTLNLHDKPTINSSTLEADPGGDMSEEDMLQAAMNMSLESARNHLSTEEKK", "length": 363 }, "evidence": [ { "id": "A0A0R4ITP2", "url": "https://omabrowser.org/oma/group/A0A0R4ITP2/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "protein deubiquitination", "id": "GO:0016579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016579", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "pmid": "" }, { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "pmid": "" }, { "name": "photoreceptor cell development", "id": "GO:0042461", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042461", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "pmid": "" }, { "name": "positive regulation of ERAD pathway", "id": "GO:1904294", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904294", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "pmid": "" }, { "name": "protein quality control for misfolded or incompletely synthesized proteins", "id": "GO:0006515", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006515", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "pmid": "" }, { "name": "negative regulation of TORC1 signaling", "id": "GO:1904262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904262", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cysteine-type deubiquitinase activity", "id": "GO:0004843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004843", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ITP2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ITP2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "3.4.19.12", "ec_name": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "3.4.19.12", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.19.12" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }