{ "uniprot_canonical_ac": "A0A0R4IT47-1", "uniprot_ac": "A0A0R4IT47", "uniprot_id": "A0A0R4IT47_DANRE", "mass": { "chemical_mass": 22511.0, "monoisotopic_mass": 22511.0 }, "refseq": { "ac": "NP_001313362", "name": "metalloproteinase inhibitor 4.3 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313362" }, "gene_names": [ { "name": "timp4.3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47", "id": "A0A0R4IT47" }, { "name": "timp4.3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313362", "id": "NP_001313362" }, { "name": "timp4; timp4a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313362", "id": "NP_001313362" }, { "name": "timp4a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47", "id": "A0A0R4IT47" }, { "name": "timp4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47", "id": "A0A0R4IT47" } ], "protein_names": [ { "name": "Metalloproteinase inhibitor 4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47/entry#names_and_taxonomy", "id": "A0A0R4IT47" }, { "name": "TIMP2d; TIMP metallopeptidase inhibitor 4a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313362", "id": "NP_001313362" }, { "name": "Tissue inhibitor of metalloproteinases 4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47/entry#names_and_taxonomy", "id": "A0A0R4IT47" }, { "name": "metalloproteinase inhibitor 4.3 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313362", "id": "NP_001313362" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: BC093210.1, EH472853.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505371 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EH447003.1 and EH479172.1. On May 18, 2016 this sequence version replaced XP_009303999.1.", "evidence": [ { "database": "RefSeq", "id": "NP_001313362", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313362" } ] } ], "disease": [ { "disease_id": "DOID:0060074", "recommended_name": { "id": "DOID:0060074", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060074", "name": "ductal carcinoma in situ", "description": "A breast carcinoma in situ that is characterized by being non-invasive, not having spread outside of the duct into the surrounding breast tissue, has_material_basis_in abnormally proliferating cells, derives_from epithelial cells." }, "synonyms": [], "unlinked_id_list": [], "evidence": [ { "id": "0060074", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060074" } ] }, { "disease_id": "DOID:1073", "recommended_name": { "id": "DOID:1073", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1073", "name": "renal hypertension", "description": "" }, "synonyms": [], "unlinked_id_list": [], "evidence": [ { "id": "1073", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1073" } ] }, { "disease_id": "DOID:1380", "recommended_name": { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "endometrial cancer", "description": "A uterine cancer that is located_in tissues lining the uterus." }, "synonyms": [ { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "endometrial Ca", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "endometrial neoplasm", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "malignant endometrial neoplasm", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "malignant neoplasm of endometrium", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "neoplasm of endometrium", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "primary malignant neoplasm of endometrium", "description": "" }, { "id": "DOID:1380", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1380", "name": "tumor of Endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial cancer", "description": "Primary or metastatic malignant neoplasm involving the endometrium (mucous membrane that lines the endometrial cavity)." }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial neoplasm", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "neoplasm of endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "tumor of endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "tumour of endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "cancer of endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial Ca", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial cancer", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial cancer, familial, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrial carcinoma, somatic", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "endometrium cancer", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "malignant endometrial neoplasm", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "malignant endometrium neoplasm", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "malignant neoplasm of endometrium", "description": "" }, { "id": "MONDO:0011962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011962", "name": "primary malignant neoplasm of endometrium", "description": "" }, { "id": "MIM:608089", "resource": "MIM", "url": "https://www.omim.org/entry/608089", "name": "Endometrial cancer", "description": "Endometrial cancer" } ], "unlinked_id_list": [ "DOID:5166" ], "evidence": [ { "id": "1380", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1380" } ] }, { "disease_id": "DOID:2154", "recommended_name": { "id": "DOID:2154", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2154", "name": "nephroblastoma", "description": "A kidney cancer that affects the kidneys and typically occuring in children." }, "synonyms": [ { "id": "DOID:2154", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2154", "name": "adult nephroblastoma", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "Wilms tumor 1", "description": "An autosomal disorder due to pathogenic variants in the WT1 gene leading to an increased risk Wilms tumor and genitourinary abnormalities incorporating Denys-Drash syndrome and Frasier syndrome." }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "Wilms' tumor", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "Wilms' tumour", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "renal Wilms tumor", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "renal Wilms tumour", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "WT1-related Wilms tumor predisposition", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "Wilms tumor 1", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "Wilms tumor type 1", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "Wilms tumor, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "Wilms tumor, somatic", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "Wilms tumor, type 1, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "Wilms tumour type 1", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "WT1", "description": "" }, { "id": "MONDO:0008679", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008679", "name": "nephroblastoma", "description": "" }, { "id": "MIM:194070", "resource": "MIM", "url": "https://www.omim.org/entry/194070", "name": "Wilms tumor 1", "description": "Wilms tumor 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "2154", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2154" } ] }, { "disease_id": "DOID:2871", "recommended_name": { "id": "DOID:2871", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2871", "name": "endometrial carcinoma", "description": "A endometrial cancer that is located_in the tissue lining the uterus." }, "synonyms": [ { "id": "DOID:2871", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2871", "name": "endometrioid carcinoma of female Reproductive system", "description": "" }, { "id": "DOID:2871", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2871", "name": "carcinoma of the Endometrium", "description": "" }, { "id": "DOID:2871", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2871", "name": "endometrioid carcinoma", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "2871", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2871" } ] }, { "disease_id": "DOID:4001", "recommended_name": { "id": "DOID:4001", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4001", "name": "ovarian carcinoma", "description": "An ovarian cancer that has_material_basis_in epithelial tissue and is located_in the ovary." }, "synonyms": [], "unlinked_id_list": [], "evidence": [ { "id": "4001", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4001" } ] }, { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] }, { "disease_id": "DOID:4450", "recommended_name": { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "renal cell carcinoma", "description": "A renal carcinoma that has_material_basis_in the lining of the proximal convoluted renal tubule of the kidney." }, "synonyms": [ { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "RCC", "description": "" }, { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "adenocarcinoma of kidney", "description": "" }, { "id": "DOID:4450", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4450", "name": "hypernephroma", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "renal cell carcinoma, Xp11-associated", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "renal cell carcinoma, Xp11-associated", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "renal cell carcinoma, papillary, 1", "description": "" }, { "id": "MONDO:0010456", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010456", "name": "RCCX1", "description": "" }, { "id": "MIM:300854", "resource": "MIM", "url": "https://www.omim.org/entry/300854", "name": "Renal cell carcinoma Xp11-associated", "description": "Renal cell carcinoma Xp11-associated" } ], "unlinked_id_list": [ "DOID:4455" ], "evidence": [ { "id": "4450", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4450" } ] }, { "disease_id": "DOID:6000", "recommended_name": { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "congestive heart failure", "description": "A heart disease that is characterized by any structural or functional cardiac disorder that impairs the ability of the heart to fill with or pump a sufficient amount of blood throughout the body." }, "synonyms": [ { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "CHF", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Cardiac Failure Congestive", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Congestive heart disease", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Weak heart", "description": "" } ], "unlinked_id_list": [ "DOID:12326" ], "evidence": [ { "id": "6000", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:6000" } ] }, { "disease_id": "DOID:7693", "recommended_name": { "id": "DOID:7693", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7693", "name": "abdominal aortic aneurysm", "description": "An aortic aneurysm that is located_in the abdominal aorta." }, "synonyms": [ { "id": "DOID:7693", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7693", "name": "AORTIC ANEURYSM, FAMILIAL ABDOMINAL 1", "description": "" }, { "id": "MONDO:0012343", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012343", "name": "aortic aneurysm, familial abdominal, 2", "description": "" }, { "id": "MONDO:0012343", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012343", "name": "AAA2", "description": "" }, { "id": "MONDO:0012343", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012343", "name": "aortic aneurysm, familial abdominal 2", "description": "" }, { "id": "MONDO:0012343", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012343", "name": "aortic aneurysm, familial abdominal, 2", "description": "" }, { "id": "MONDO:0024521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024521", "name": "aortic aneurysm, familial abdominal, 1", "description": "" }, { "id": "MONDO:0024521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024521", "name": "AAA1", "description": "" }, { "id": "MONDO:0024521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024521", "name": "aortic aneurysm, familial abdominal 1", "description": "" }, { "id": "MONDO:0024521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024521", "name": "aortic aneurysm, familial abdominal, 1", "description": "" }, { "id": "MONDO:0024521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024521", "name": "abdominal aortic aneurysm", "description": "" }, { "id": "MONDO:0024521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024521", "name": "aneurysm, abdominal aortic", "description": "" }, { "id": "MONDO:0013716", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013716", "name": "aortic aneurysm, familial abdominal, 4", "description": "" }, { "id": "MONDO:0013716", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013716", "name": "AAA4", "description": "" }, { "id": "MONDO:0013716", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013716", "name": "aortic aneurysm, familial abdominal, 4", "description": "" }, { "id": "MONDO:0012751", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012751", "name": "aortic aneurysm, familial abdominal, 3", "description": "" }, { "id": "MONDO:0012751", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012751", "name": "AAA3", "description": "" }, { "id": "MONDO:0012751", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012751", "name": "aneurysm, familial abdominal 3", "description": "" }, { "id": "MONDO:0012751", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012751", "name": "aortic aneurysm, familial abdominal, 3", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "7693", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:7693" } ] }, { "disease_id": "DOID:8634", "recommended_name": { "id": "DOID:8634", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8634", "name": "prostate carcinoma in situ", "description": "An in situ carcinoma that is located_in the prostate." }, "synonyms": [ { "id": "DOID:8634", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8634", "name": "PIN III", "description": "" }, { "id": "DOID:8634", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8634", "name": "carcinoma in situ of prostate", "description": "" }, { "id": "DOID:8634", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8634", "name": "grade III PIN", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "8634", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:8634" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "timp4.3", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-070824-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070824-1", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000100795", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000100795", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03577", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03577", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100124610", "url": "https://www.ncbi.nlm.nih.gov/gene/100124610", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001134", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001134", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001820", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001820", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008993", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008993", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027465", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027465", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030490", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030490", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:100124610", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100124610", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CVCEIAS", "url": "https://omabrowser.org/oma/group/CVCEIAS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IT47", "url": "https://www.orthodb.org/?gene=A0A0R4IT47", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11844", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11844", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11844:SF26", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11844:SF26", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00965", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00965", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001313362", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313362", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IT47-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-070824-1", "url": "https://zfin.org/ZDB-GENE-070824-1", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MMKMKMCVTAGLLFLMCVCLKEHMLEACSCGPAHPQELFCHADVVFKARVLSMKLIKSMYPGEGYFKFNINITKMYKGFEHAGIKHFFTPEDEGMCGISLTRSVYLFSGKLVSRHEGHAKKSLTVDLCDIVKHWSRLSKTEKKILSVHRKACNCQVSHCYIEPCDENKCYLRDIYDPDEGSQSICMANSTGSCRWINA", "length": 198, "header": "tr|A0A0R4IT47-1|A0A0R4IT47_DANRE Isoform 1 of Metalloproteinase inhibitor 4 OS=Danio rerio OX=7955 GN=timp4.3 PE=3 SV=1 CANONICAL=A0A0R4IT47-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IT47-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47/entry#A0A0R4IT47-1", "sequence": { "sequence": "MMKMKMCVTAGLLFLMCVCLKEHMLEACSCGPAHPQELFCHADVVFKARVLSMKLIKSMYPGEGYFKFNINITKMYKGFEHAGIKHFFTPEDEGMCGISLTRSVYLFSGKLVSRHEGHAKKSLTVDLCDIVKHWSRLSKTEKKILSVHRKACNCQVSHCYIEPCDENKCYLRDIYDPDEGSQSICMANSTGSCRWINA", "length": 198, "header": "tr|A0A0R4IT47-1|A0A0R4IT47_DANRE Isoform 1 of Metalloproteinase inhibitor 4 OS=Danio rerio OX=7955 GN=timp4.3 PE=3 SV=1 CANONICAL=A0A0R4IT47-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The evolution of the vertebrate metzincins; insights from Ciona intestinalis and Danio rerio.", "journal": "BMC Evol. Biol.", "date": "2007", "authors": "Huxley-Jones Julie, Clarke Toni-Kim, Beck Christine, Toubaris George, Robertson David L, Boot-Handford Raymond P", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "reference": [ { "type": "PubMed", "id": "17439641", "url": "https://glygen.org/publication/PubMed/17439641" } ] }, { "title": "The zebrafish embryo: a powerful model system for investigating matrix remodeling.", "journal": "Zebrafish", "date": "2009", "authors": "Wyatt Rachael A, Keow Jonathan Y, Harris Natalie D, Hach\u00e9 Charles A, Li Daniel H, Crawford Bryan D", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "reference": [ { "type": "PubMed", "id": "19929220", "url": "https://glygen.org/publication/PubMed/19929220" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Differential expression of synapsin genes during early zebrafish development.", "journal": "Neuroscience", "date": "2014", "authors": "Garbarino G, Costa S, Pestarino M, Candiani S", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "reference": [ { "type": "PubMed", "id": "25239370", "url": "https://glygen.org/publication/PubMed/25239370" } ] }, { "title": "Gene evolution and gene expression after whole genome duplication in fish: the PhyloFish database.", "journal": "BMC Genomics", "date": "2016", "authors": "Pasquier Jeremy, Cabau C\u00e9dric, Nguyen Thaovi, Jouanno Elodie, Severac Dany, Braasch Ingo, Journot Laurent, Pontarotti Pierre, Klopp Christophe, Postlethwait John H, Guiguen Yann, Bobe Julien", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "reference": [ { "type": "PubMed", "id": "27189481", "url": "https://glygen.org/publication/PubMed/27189481" } ] }, { "title": "IGFBP1 increases beta-cell regeneration by promoting alpha- to beta-cell transdifferentiation.", "journal": "EMBO J.", "date": "2016", "authors": "Lu Jing, Liu Ka-Cheuk, Schulz Nadja, Karampelias Christos, Charbord J\u00e9r\u00e9mie, Hilding Agneta, Rautio Linn, Bertolino Philippe, \u00d6stenson Claes-G\u00f6ran, Brismar Kerstin, Andersson Olov", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "reference": [ { "type": "PubMed", "id": "27516442", "url": "https://glygen.org/publication/PubMed/27516442" } ] }, { "title": "TAMM41 is required for heart valve differentiation via regulation of PINK-PARK2 dependent mitophagy.", "journal": "Cell Death Differ.", "date": "2019", "authors": "Yang Rui Meng, Tao Jiong, Zhan Ming, Yuan Hao, Wang Hai Hong, Chen Sai Juan, Chen Zhu, de Th\u00e9 Hugues, Zhou Jun, Guo Ying, Zhu Jun", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "reference": [ { "type": "PubMed", "id": "30824836", "url": "https://glygen.org/publication/PubMed/30824836" } ] }, { "title": "Paralogues of Mmp11 and Timp4 Interact during the Development of the Myotendinous Junction in the Zebrafish Embryo.", "journal": "J. Dev. Biol.", "date": "2019", "authors": "Matchett Emma F, Wang Shuaijin, Crawford Bryan D", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "reference": [ { "type": "PubMed", "id": "31816958", "url": "https://glygen.org/publication/PubMed/31816958" } ] } ], "pathway": [ { "id": "dre:100124610", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100124610", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A2R8Q0U9-1", "protein_name": "Metalloproteinase inhibitor 4", "gene_name": "timp4.1", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MMMMMMMKMCTRECVTAGLLFFMCVCLNQQMLEACSCASAHPQQLFCSADAVLRAEITGEKIRRREDINPMYGLGKIQYEVQVIKVFKGSDRIKDLQHVYTHEMSSMCGIRLNRGQYLLSGSMMSEGFFVTLCDFVEHWDRLSLTQKKNLKYRYQMGCNCTISICTEQPCHPKVKNECILTDWSSLWPFEDGEPVHEYACIRHSDGSCSWHEGGTSVPSEKNTTDISEG", "length": 229 }, "evidence": [ { "id": "HGNC:11823", "url": "https://alliancegenome.org/gene/HGNC:11823#orthology", "database": "AGR" }, { "id": "MGI:109125", "url": "https://alliancegenome.org/gene/MGI:109125#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1P9Q2-1", "protein_name": "Metalloproteinase inhibitor 4", "gene_name": "timp4.2", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MMKMKMYVSAGLLFFMCVCLNEQMLEACSCIPFHPQQEFCYSSAVIKAMVLDEEPIPGQDPEEIKYKINVLQVFKGAEHAGIEYLHTASDGAMCGIRLRPGIYLLAVRGVHVGLCDLVVRWDNLSKTHKKILSLGQEACDCKVSHCFKEPCDENKCYLTDMFDSVKLYSESICMANSTGSCRWINAY", "length": 187 }, "evidence": [ { "id": "RGD:69077", "url": "https://alliancegenome.org/gene/RGD:69077#orthology", "database": "AGR" }, { "id": "HGNC:11823", "url": "https://alliancegenome.org/gene/HGNC:11823#orthology", "database": "AGR" }, { "id": "MGI:109125", "url": "https://alliancegenome.org/gene/MGI:109125#orthology", "database": "AGR" }, { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "P01033-1", "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "TIMP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA", "length": 207 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P12032-1", "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "Timp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMAPFASLASGILLLLSLIASSKACSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR", "length": 205 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P16035-1", "protein_name": "Metalloproteinase inhibitor 2", "gene_name": "TIMP2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP", "length": 220 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P25785-1", "protein_name": "Metalloproteinase inhibitor 2", "gene_name": "Timp2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGAAARSLRLALGLLLLASLVRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP", "length": 220 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P30120-1", "protein_name": "Metalloproteinase inhibitor 1", "gene_name": "Timp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAPFASLASGILLLLSLIASSKACSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA", "length": 217 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P30121-1", "protein_name": "Metalloproteinase inhibitor 2", "gene_name": "Timp2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGAAARSLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP", "length": 220 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P35625-1", "protein_name": "Metalloproteinase inhibitor 3", "gene_name": "TIMP3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP", "length": 211 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P39876-1", "protein_name": "Metalloproteinase inhibitor 3", "gene_name": "Timp3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTPWLGLVVLLSCWSLGHWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNFVERWDHLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSISNATDP", "length": 211 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P48032-1", "protein_name": "Metalloproteinase inhibitor 3", "gene_name": "Timp3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTPWLGLVVLLSCWSLGHWGTEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNFVERWDHLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKKECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSISNATDP", "length": 211 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P81556-1", "protein_name": "Metalloproteinase inhibitor 4", "gene_name": "Timp4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPWSPLAALSWALVLRLLALLWPPGRGEACSCAPAHPQQHVCHSALVIRAKISSEKVVPASEDPADTQKMIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSQKQYLLTGQILSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPDECLWTDWLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIVQP", "length": 224 }, "evidence": [ { "id": "ZFIN:ZDB-GENE-070824-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070824-1#orthology", "database": "AGR" }, { "id": "RGD:69077", "url": "https://alliancegenome.org/gene/RGD:69077#orthology", "database": "AGR" }, { "id": "HGNC:11823", "url": "https://alliancegenome.org/gene/HGNC:11823#orthology", "database": "AGR" }, { "id": "MGI:109125", "url": "https://alliancegenome.org/gene/MGI:109125#orthology", "database": "AGR" }, { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6NUX9-1", "protein_name": "Metalloproteinase inhibitor 2", "gene_name": "timp2b", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MSMSRSVPLLLLVLCGATDFAGACSCSPEHPQQAYCNADVVIRAKVVGRKEVVTGNDAYGYPIKMIRYDVKQLKMFKGPNGEIDTIFTGPSSALCGVNLESNGKQEYLITGNLNSNGTLRINLCDYIESWESLSLTQKKSLGPRYQMGCDCKIVQCPIIPCSISEPVECLWTDWVLEGTVQGTQAQHYTCVKRSDSSCAWYRGSTPPKKEFMDIEEP", "length": 217 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q7SZM6-1", "protein_name": "Metalloproteinase inhibitor 2", "gene_name": "timp2a", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MKSVRSCIGTLVVLVLFRVGEIAEACSCSPVHPQQAFCNADVVIRAKVVGKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDRHIDVVFTAPSSAVCGVTNLDTNGKKEYLISGKAEANGKMHVTLCDLIMPWESMSATQKKSLSQRYQMGCDCKITRCATFPCEISAPEECLWTDWVTEKIIHGRQSDHYACIKRGDGSCAWYRGVAPPKKEFLEVEDP", "length": 220 }, "evidence": [ { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q99727-1", "protein_name": "Metalloproteinase inhibitor 4", "gene_name": "TIMP4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP", "length": 224 }, "evidence": [ { "id": "ZFIN:ZDB-GENE-070824-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070824-1#orthology", "database": "AGR" }, { "id": "RGD:69077", "url": "https://alliancegenome.org/gene/RGD:69077#orthology", "database": "AGR" }, { "id": "HGNC:11823", "url": "https://alliancegenome.org/gene/HGNC:11823#orthology", "database": "AGR" }, { "id": "MGI:109125", "url": "https://alliancegenome.org/gene/MGI:109125#orthology", "database": "AGR" }, { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9JHB3-1", "protein_name": "Metalloproteinase inhibitor 4", "gene_name": "Timp4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPWSPLAALSWALVLRLLALLWPPGRGEACSCAPAHPQQHFCHSALVIRAKISSEKVVPASKDPADTQKLIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSHKQYLLTGQILSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIIQP", "length": 224 }, "evidence": [ { "id": "ZFIN:ZDB-GENE-070824-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070824-1#orthology", "database": "AGR" }, { "id": "RGD:69077", "url": "https://alliancegenome.org/gene/RGD:69077#orthology", "database": "AGR" }, { "id": "HGNC:11823", "url": "https://alliancegenome.org/gene/HGNC:11823#orthology", "database": "AGR" }, { "id": "MGI:109125", "url": "https://alliancegenome.org/gene/MGI:109125#orthology", "database": "AGR" }, { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VH14-1", "protein_name": "Tissue inhibitor of metalloproteinase", "gene_name": "Timp", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MDLRKHLGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPGRTTYKVHIKRTYKATSEARRMLRDGRLSTPQDDAMCGINLDLGKVYIVAGRMPTLNICSYYKEYTRMTITERHGFSGGYAKATNCTVTPCFGERCFKGRNYADTCKWSPFGKCETNYSACMPHKVQTVNGVISRCRWRRTQLYRKCMSNP", "length": 210 }, "evidence": [ { "id": "ZFIN:ZDB-GENE-070824-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-070824-1#orthology", "database": "AGR" }, { "id": "RGD:69077", "url": "https://alliancegenome.org/gene/RGD:69077#orthology", "database": "AGR" }, { "id": "HGNC:11823", "url": "https://alliancegenome.org/gene/HGNC:11823#orthology", "database": "AGR" }, { "id": "MGI:109125", "url": "https://alliancegenome.org/gene/MGI:109125#orthology", "database": "AGR" }, { "id": "FB:FBgn0025879", "url": "https://alliancegenome.org/gene/FB:FBgn0025879#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "negative regulation of membrane protein ectodomain proteolysis", "id": "GO:0051045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051045", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "pmid": "" }, { "name": "response to cytokine", "id": "GO:0034097", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034097", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "pmid": "" }, { "name": "response to hormone", "id": "GO:0009725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009725", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "pmid": "" }, { "name": "metalloendopeptidase inhibitor activity", "id": "GO:0008191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008191", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IT47", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IT47" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 188, "end_pos": 190, "annotation": "n_glycosylation_sequon" }, { "start_pos": 71, "end_pos": 73, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 188, "end_pos": 190 }, { "start_pos": 71, "end_pos": 73 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }