{ "uniprot_canonical_ac": "A0A0R4IS85-1", "uniprot_ac": "A0A0R4IS85", "uniprot_id": "A0A0R4IS85_DANRE", "mass": { "chemical_mass": 19393.0, "monoisotopic_mass": 19393.0 }, "refseq": { "ac": "NP_001258699", "name": "glucagon a isoform 1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258699" }, "gene_names": [ { "name": "gcga", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85", "id": "A0A0R4IS85" }, { "name": "gcg; glu; zgc:103616", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258699", "id": "NP_001258699" }, { "name": "gcga", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258699", "id": "NP_001258699" }, { "name": "gcg", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85", "id": "A0A0R4IS85" }, { "name": "glu", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85", "id": "A0A0R4IS85" }, { "name": "zgc:103616", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85", "id": "A0A0R4IS85" } ], "protein_names": [ { "name": "GLP-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258699", "id": "NP_001258699" }, { "name": "Glucagon a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85/entry#names_and_taxonomy", "id": "A0A0R4IS85" }, { "name": "glucagon a isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258699", "id": "NP_001258699" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: GFIL01011279.1, EH445427.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA3505371, SAMEA3505388 [ECO:0006172] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JBMGRA010000022.1. Transcript Variant: This variant (1) encodes the longer protein (isoform 1). Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.", "evidence": [ { "database": "RefSeq", "id": "NP_001258699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258699" } ] } ], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "10652", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:11716", "recommended_name": { "id": "DOID:11716", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11716", "name": "prediabetes syndrome", "description": "A glucose metabolism disease that is characterized by blood glucose levels are high, but not high enough to be classified as type 2 diabetes." }, "synonyms": [ { "id": "DOID:11716", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11716", "name": "Prediabetes", "description": "" }, { "id": "DOID:11716", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11716", "name": "prediabetic state", "description": "" }, { "id": "DOID:11716", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11716", "name": "impaired glucose tolerance", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "11716", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11716" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IS85", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "gcga", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-010219-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-010219-1", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000079296", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000079296", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "494052", "url": "https://www.ncbi.nlm.nih.gov/gene/494052", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000532", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000532", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015550", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015550", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:494052", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:494052", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "RWLMNAK", "url": "https://omabrowser.org/oma/group/RWLMNAK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IS85", "url": "https://www.orthodb.org/?gene=A0A0R4IS85", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "F1RD10", "url": "https://www.orthodb.org/?gene=F1RD10", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11418", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11418", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11418:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11418:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00123", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00123", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001258699", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258699", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IS85", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IS85-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1RD10-1", "url": "https://www.uniprot.org/uniprotkb/F1RD10-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-010219-1", "url": "https://zfin.org/ZDB-GENE-010219-1", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MKGVQYFASLLLLLFVHKCICVPLQGDSTSTETADSFLARAPGLTTMKRHSEGTFSNDYSKYLETRRAQDFVQWLMNAKRNGGSVKRHAEGTYTSDVSSYLQDQAAQSFVAWLKSGQPKPDVANNKGANMAQRRHVDGSFTSDVNKVLDSIAAKEYLQWVMNSKASGTSGKRGGNQ", "length": 176, "header": "tr|A0A0R4IS85-1|A0A0R4IS85_DANRE Isoform 1 of Glucagon a OS=Danio rerio OX=7955 GN=gcga PE=3 SV=1 CANONICAL=A0A0R4IS85-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IS85-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85/entry#A0A0R4IS85-1", "sequence": { "sequence": "MKGVQYFASLLLLLFVHKCICVPLQGDSTSTETADSFLARAPGLTTMKRHSEGTFSNDYSKYLETRRAQDFVQWLMNAKRNGGSVKRHAEGTYTSDVSSYLQDQAAQSFVAWLKSGQPKPDVANNKGANMAQRRHVDGSFTSDVNKVLDSIAAKEYLQWVMNSKASGTSGKRGGNQ", "length": 176, "header": "tr|A0A0R4IS85-1|A0A0R4IS85_DANRE Isoform 1 of Glucagon a OS=Danio rerio OX=7955 GN=gcga PE=3 SV=1 CANONICAL=A0A0R4IS85-1" }, "locus": {} }, { "isoform_ac": "F1RD10-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85/entry#F1RD10-1", "sequence": { "sequence": "MKGVQYFASLLLLLFVHKCICVPLQGDSTSTETADSFLARAPGLTTMKRHSEGTFSNDYSKYLETRRAQDFVQWLMNAKRNGGSVKRHAEGTYTSDVSSYLQDQAAQSFVAWLKSGQPKPE", "length": 121, "header": "tr|F1RD10-1|A0A0R4IS85_DANRE Computationally mapped isoform of Glucagon a OS=Danio rerio OX=7955 GN=gcga PE=3 SV=1 CANONICAL=A0A0R4IS85-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Early appearance of pancreatic hormone-expressing cells in the zebrafish embryo.", "journal": "Mech. Dev.", "date": "1999", "authors": "Argenton F, Zecchin E, Bortolussi M", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "10495291", "url": "https://glygen.org/publication/PubMed/10495291" } ] }, { "title": "Pancreas development in zebrafish: early dispersed appearance of endocrine hormone expressing cells and their convergence to form the definitive islet.", "journal": "Dev. Biol.", "date": "2001", "authors": "Biemar F, Argenton F, Schmidtke R, Epperlein S, Peers B, Driever W", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "11161572", "url": "https://glygen.org/publication/PubMed/11161572" } ] }, { "title": "Zebrafish pdx1 morphant displays defects in pancreas development and digestive organ chirality, and potentially identifies a multipotent pancreas progenitor cell.", "journal": "Genesis", "date": "2001", "authors": "Yee N S, Yusuff S, Pack M", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "11477692", "url": "https://glygen.org/publication/PubMed/11477692" } ] }, { "title": "Sonic hedgehog is required early in pancreatic islet development.", "journal": "Dev. Biol.", "date": "2002", "authors": "diIorio Philip J, Moss Jennifer B, Sbrogna Jennifer L, Karlstrom Rolf O, Moss Larry G", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "11900460", "url": "https://glygen.org/publication/PubMed/11900460" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Tpo knockout in zebrafish partially recapitulates clinical manifestations of congenital hypothyroidism and reveals the involvement of TH in proper development of glucose homeostasis.", "journal": "Gen. Comp. Endocrinol.", "date": "2022", "authors": "Fang Ya, Wan Jia-Ping, Zhang Rui-Jia, Sun Feng, Yang Liu, Zhao Shuang-Xia, Dong Mei, Song Huai-Dong", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "35367205", "url": "https://glygen.org/publication/PubMed/35367205" } ] }, { "title": "Effect of aerobic exercise as a treatment on type 2 diabetes mellitus with depression-like behavior zebrafish.", "journal": "Life Sci.", "date": "2022", "authors": "Wang Lei, Ma Jiahui, Wu Wei, Fang Yimeng, Liu Fan, Yang Qinsi, Hu Xiang, Gu Xuejiang, He Zhiying, Sun Da, Jin Libo, Zhang Xingxing", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "35489565", "url": "https://glygen.org/publication/PubMed/35489565" } ] }, { "title": "Ercc2/Xpd deficiency results in failure of digestive organ growth in zebrafish with elevated nucleolar stress.", "journal": "IScience", "date": "2022", "authors": "Ma Jinmin, Shao Xuelian, Geng Fang, Liang Shuzhang, Yu Chunxiao, Zhang Ruilin", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "36065184", "url": "https://glygen.org/publication/PubMed/36065184" } ] }, { "title": "Disruption of the glucagon receptor increases glucagon expression beyond alpha-cell hyperplasia in zebrafish.", "journal": "J. Biol. Chem.", "date": "2022", "authors": "Kang Qi, Zheng Jihong, Jia Jianxin, Xu Ying, Bai Xuanxuan, Chen Xinhua, Zhang Xiao-Kun, Wong F Susan, Zhang Chao, Li Mingyu", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "36334626", "url": "https://glygen.org/publication/PubMed/36334626" } ] }, { "title": "Hyperaminoacidemia induces pancreatic alpha cell proliferation via synergism between the mTORC1 and CaSR-Gq signaling pathways.", "journal": "Nat. Commun.", "date": "2023", "authors": "Gong Yulong, Yang Bingyuan, Zhang Dingdong, Zhang Yue, Tang Zihan, Yang Liu, Coate Katie C, Yin Linlin, Covington Brittney A, Patel Ravi S, Siv Walter A, Sellick Katelyn, Shou Matthew, Chang Wenhan, Danielle Dean E, Powers Alvin C, Chen Wenbiao", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "36646689", "url": "https://glygen.org/publication/PubMed/36646689" } ] }, { "title": "Glucagon-like peptide-1 activates the adenylyl cyclase system in rockfish enterocytes and brain membranes.", "journal": "Comp. Biochem. Physiol. B, Biochem. Mol. Biol.", "date": "1998", "authors": "Mommsen T P, Mojsov S", "evidence": [ { "database": "UniProtKB", "id": "F1RD10", "url": "https://www.uniprot.org/uniprotkb/F1RD10" } ], "reference": [ { "type": "PubMed", "id": "9972283", "url": "https://glygen.org/publication/PubMed/9972283" } ] } ], "pathway": [ { "id": "dre:494052", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:494052", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "B0R1C3-1", "protein_name": "Glucagon b", "gene_name": "gcgb", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MMVRIYAFIGLLLLILIQSSLQIPLQDTEENGSLMSEDVLFNDPREVNTMKRHSEGTFSNDYSKYLETRRAQDFVQWLMNSKRSGVPTRRHADGTYTSDVSSYLQDQAAKEFVSWLKTGRGRRE", "length": 124 }, "evidence": [ { "id": "HGNC:4191", "url": "https://alliancegenome.org/gene/HGNC:4191#orthology", "database": "AGR" }, { "id": "MGI:95674", "url": "https://alliancegenome.org/gene/MGI:95674#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK", "length": 180 }, "evidence": [ { "id": "HGNC:4191", "url": "https://alliancegenome.org/gene/HGNC:4191#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-010219-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-010219-1#orthology", "database": "AGR" }, { "id": "MGI:95674", "url": "https://alliancegenome.org/gene/MGI:95674#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P06883-1", "protein_name": "Pro-glucagon", "gene_name": "Gcg", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKTVYIVAGLFVMLVQGSWQHAPQDTEENARSFPASQTEPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMNTILDNLATRDFINWLIQTKITDKK", "length": 180 }, "evidence": [ { "id": "HGNC:4191", "url": "https://alliancegenome.org/gene/HGNC:4191#orthology", "database": "AGR" }, { "id": "MGI:95674", "url": "https://alliancegenome.org/gene/MGI:95674#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P55095-1", "protein_name": "Pro-glucagon", "gene_name": "Gcg", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKTIYFVAGLLIMLVQGSWQHALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMSTILDNLATRDFINWLIQTKITDKK", "length": 180 }, "evidence": [ { "id": "HGNC:4191", "url": "https://alliancegenome.org/gene/HGNC:4191#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-010219-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-010219-1#orthology", "database": "AGR" }, { "id": "MGI:95674", "url": "https://alliancegenome.org/gene/MGI:95674#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "glucagon receptor binding", "id": "GO:0031769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031769", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IS85", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85" } ], "pmid": "" }, { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IS85", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IS85", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "response to starvation", "id": "GO:0042594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042594", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IS85", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85" } ], "pmid": "" }, { "name": "type B pancreatic cell development", "id": "GO:0003323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003323", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IS85", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IS85" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }