{ "uniprot_canonical_ac": "A0A0R4IR31-1", "uniprot_ac": "A0A0R4IR31", "uniprot_id": "A0A0R4IR31_DANRE", "mass": { "chemical_mass": 28414.0, "monoisotopic_mass": 28414.0 }, "refseq": { "ac": "NP_001005943", "name": "uncharacterized protein LOC103911540 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005943" }, "gene_names": [ { "name": "mhc2dhb", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31", "id": "A0A0R4IR31" }, { "name": "mhc2dhb", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005943", "id": "NP_001005943" }, { "name": "zgc:103700", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005943", "id": "NP_001005943" }, { "name": "zgc:103700", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31", "id": "A0A0R4IR31" } ], "protein_names": [ { "name": "H-2 class II histocompatibility antigen, E-S beta chain-like; MHCII", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005943", "id": "NP_001005943" }, { "name": "Uncharacterized protein LOC103911540 precursor", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31/entry#names_and_taxonomy", "id": "A0A0R4IR31" }, { "name": "Zgc:103700", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31/entry#names_and_taxonomy", "id": "A0A0R4IR31" }, { "name": "uncharacterized protein LOC103911540 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005943", "id": "NP_001005943" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: GFIL01045080.1, BC083466.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA708836, SAMN08196787 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EH452369.1, EH465241.1 and JBMGRA010000008.1. On or before Mar 29, 2018 this sequence version replaced XP_009302405.1, NP_001005943.2. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.", "evidence": [ { "database": "RefSeq", "id": "NP_001005943", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005943" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "mhc2dhb", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31", "locus": {} } ], "crossref": [ { "id": "ENSDARG00000116524", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000116524", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "103911540", "url": "https://www.ncbi.nlm.nih.gov/gene/103911540", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000353", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000353", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003597", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003597", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014745", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014745", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050160", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050160", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:103911540", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:103911540", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LYDWDPM", "url": "https://omabrowser.org/oma/group/LYDWDPM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IR31", "url": "https://www.orthodb.org/?gene=A0A0R4IR31", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19944", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19944", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19944:SF99", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19944:SF99", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00969", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00969", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07654", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07654", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001005943", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005943", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IR31-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYLLKLFLAILMLAAFTGTAYGYYDYTKFECIYSTSDYSDMVYLVSLSFNKFVDIKCNSTEVKCVGFTEQGVKFADNFNKDKAFLQNLKASVDTFCRHNAEIIDSAVRDKAVKPKVIMKSVKQAEGRHPAMLQCSAYEFYPKKIKMYWLRDSKVITSDVTSTMEMANGNWYYQIHSHLEYTPKNGEKIQCVVEHASSTQPITKEWNPHISESDRNKFAIGASGLVLGIIIAIAGLIYYKKKSTGRILVPN", "length": 250, "header": "tr|A0A0R4IR31-1|A0A0R4IR31_DANRE Isoform 1 of Zgc:103700 OS=Danio rerio OX=7955 GN=mhc2dhb PE=1 SV=1 CANONICAL=A0A0R4IR31-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IR31-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31/entry#A0A0R4IR31-1", "sequence": { "sequence": "MYLLKLFLAILMLAAFTGTAYGYYDYTKFECIYSTSDYSDMVYLVSLSFNKFVDIKCNSTEVKCVGFTEQGVKFADNFNKDKAFLQNLKASVDTFCRHNAEIIDSAVRDKAVKPKVIMKSVKQAEGRHPAMLQCSAYEFYPKKIKMYWLRDSKVITSDVTSTMEMANGNWYYQIHSHLEYTPKNGEKIQCVVEHASSTQPITKEWNPHISESDRNKFAIGASGLVLGIIIAIAGLIYYKKKSTGRILVPN", "length": 250, "header": "tr|A0A0R4IR31-1|A0A0R4IR31_DANRE Isoform 1 of Zgc:103700 OS=Danio rerio OX=7955 GN=mhc2dhb PE=1 SV=1 CANONICAL=A0A0R4IR31-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "A live attenuated combination vaccine evokes effective immune-mediated protection against Edwardsiella tarda and Vibrio anguillarum.", "journal": "Vaccine", "date": "2014", "authors": "Gao Yuan, Wu Haizhen, Wang Qiyao, Qu Jiangbo, Liu Qin, Xiao Jingfan, Zhang Yuanxing", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "25219565", "url": "https://glygen.org/publication/PubMed/25219565" } ] }, { "title": "Profiling immune response in zebrafish intestine, skin, spleen and kidney bath-vaccinated with a live attenuated Vibrio anguillarum vaccine.", "journal": "Fish Shellfish Immunol.", "date": "2015", "authors": "Liu Xiaohong, Wu Haizhen, Liu Qin, Wang Qiyao, Xiao Jingfan, Chang Xinyue, Zhang Yuanxing", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "25956722", "url": "https://glygen.org/publication/PubMed/25956722" } ] }, { "title": "Use of Poly(I:C) Stabilized with Chitosan As a Vaccine-Adjuvant Against Viral Hemorrhagic Septicemia Virus Infection in Zebrafish.", "journal": "Zebrafish", "date": "2015", "authors": "Kavaliauskis Arturas, Arnemo Marianne, Kim Sung-Hyun, Ulanova Lilia, Speth Martin, Novoa Beatriz, Dios Sonia, Evensen \u00d8ystein, Griffiths Gareth Wyn, Gj\u00f8en Tor", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "26509227", "url": "https://glygen.org/publication/PubMed/26509227" } ] }, { "title": "Protective effect of a recombinant VHSV-G vaccine using poly(I:C) loaded nanoparticles as an adjuvant in zebrafish (Danio rerio) infection model.", "journal": "Dev. Comp. Immunol.", "date": "2016", "authors": "Kavaliauskis Arturas, Arnemo Marianne, Speth Martin, Lagos Leidy, Rishovd Anne-Lise, Estepa Amparo, Griffiths Gareth, Gj\u00f8en Tor", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "27084059", "url": "https://glygen.org/publication/PubMed/27084059" } ] }, { "title": "Gene evolution and gene expression after whole genome duplication in fish: the PhyloFish database.", "journal": "BMC Genomics", "date": "2016", "authors": "Pasquier Jeremy, Cabau C\u00e9dric, Nguyen Thaovi, Jouanno Elodie, Severac Dany, Braasch Ingo, Journot Laurent, Pontarotti Pierre, Klopp Christophe, Postlethwait John H, Guiguen Yann, Bobe Julien", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "27189481", "url": "https://glygen.org/publication/PubMed/27189481" } ] }, { "title": "Comparative Extracellular Proteomics of Aeromonas hydrophila Reveals Iron-Regulated Secreted Proteins as Potential Vaccine Candidates.", "journal": "Front. Immunol.", "date": "2019", "authors": "Wang Yuqian, Wang Xiaoyun, Ali Farman, Li Zeqi, Fu Yuying, Yang Xiaojun, Lin Wenxiong, Lin Xiangmin", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "30833947", "url": "https://glygen.org/publication/PubMed/30833947" } ] }, { "title": "Embelin Prevents Seizure and Associated Cognitive Impairments in a Pentylenetetrazole-Induced Kindling Zebrafish Model.", "journal": "Front. Pharmacol.", "date": "2019", "authors": "Kundap Uday Praful, Paudel Yam Nath, Kumari Yatinesh, Othman Iekshan, Shaikh Mohd Farooq", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "31057394", "url": "https://glygen.org/publication/PubMed/31057394" } ] }, { "title": "Congenital asplenia due to a tlx1 mutation reduces resistance to Aeromonas hydrophila infection in zebrafish.", "journal": "Fish Shellfish Immunol.", "date": "2019", "authors": "Xie Lang, Tao Yixi, Wu Ronghua, Ye Qin, Xu Hao, Li Yun", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "31678534", "url": "https://glygen.org/publication/PubMed/31678534" } ] }, { "title": "Hydroxycoumarin efficiently inhibits spring viraemia of carp virus infection in vitro and in vivo.", "journal": "Zool. Res.", "date": "2020", "authors": "Liu Lei, Song Da-Wei, Liu Guang-Lu, Shan Li-Peng, Qiu Tian-Xiu, Chen Jiong", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "32390373", "url": "https://glygen.org/publication/PubMed/32390373" } ] }, { "title": "Congenital Asplenia Interrupts Immune Homeostasis and Leads to Excessive Systemic Inflammation in Zebrafish.", "journal": "Front. Cell. Infect. Microbiol.", "date": "2021", "authors": "Xie Lang, Chen Zheyu, Guo Hui, Tao Yixi, Miao Xiaomin, Wu Ronghua, Li Yun", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "reference": [ { "type": "PubMed", "id": "34262881", "url": "https://glygen.org/publication/PubMed/34262881" } ] } ], "pathway": [ { "id": "dre:103911540", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:103911540", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "pmid": "" }, { "name": "antigen processing and presentation of exogenous peptide antigen via MHC class II", "id": "GO:0019886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019886", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "pmid": "" }, { "name": "peptide antigen assembly with MHC class II protein complex", "id": "GO:0002503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002503", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "pmid": "" }, { "name": "positive regulation of T cell activation", "id": "GO:0050870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050870", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "pmid": "" }, { "name": "positive regulation of immune response", "id": "GO:0050778", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050778", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "pmid": "" }, { "name": "MHC class II protein complex", "id": "GO:0042613", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042613", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "MHC class II protein complex binding", "id": "GO:0023026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0023026", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "pmid": "" }, { "name": "peptide antigen binding", "id": "GO:0042605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042605", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IR31", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IR31" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 58, "end_pos": 60 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }