{ "uniprot_canonical_ac": "A0A0R4INS8-1", "uniprot_ac": "A0A0R4INS8", "uniprot_id": "A0A0R4INS8_DANRE", "mass": { "chemical_mass": 18808.0, "monoisotopic_mass": 18808.0 }, "refseq": { "ac": "NP_001070094", "name": "retinoic acid receptor responder 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070094" }, "gene_names": [ { "name": "rarres3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8", "id": "A0A0R4INS8" }, { "name": "rarres3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070094", "id": "NP_001070094" }, { "name": "zgc:154040", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070094", "id": "NP_001070094" }, { "name": "zgc:154040", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8", "id": "A0A0R4INS8" } ], "protein_names": [ { "name": "Retinoic acid receptor responder 3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8/entry#names_and_taxonomy", "id": "A0A0R4INS8" }, { "name": "retinoic acid receptor responder 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070094", "id": "NP_001070094" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: EH501496.1, BC124520.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505374, SAMEA3505375 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EH501496.1, CK027983.1, EH525615.1 and EH518500.1. On Jun 17, 2015 this sequence version replaced NP_001070094.1.", "evidence": [ { "database": "RefSeq", "id": "NP_001070094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070094" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "rarres3", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-060929-616", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-060929-616", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000093006", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000093006", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "767688", "url": "https://www.ncbi.nlm.nih.gov/gene/767688", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007053", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007053", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051496", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051496", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:767688", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:767688", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FGYAHWA", "url": "https://omabrowser.org/oma/group/FGYAHWA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4INS8", "url": "https://www.orthodb.org/?gene=A0A0R4INS8", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13943", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13943", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13943:SF31", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13943:SF31", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04970", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF04970", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001070094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001070094", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4INS8-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-060929-616", "url": "https://zfin.org/ZDB-GENE-060929-616", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MNKFDKKPQPGDLIEIFRGIYQHWAIYVGDGYVIHLVPPSEYAHAGANSMMSVLHERAKVKKENLYEVVGDHDYRINNFLDDKYEPRPIHEILQDAYSVLGQERSYSVFSGNCEHFVTELRYGKAHSRQVRKAVEMGVAAGISFGVLAYAVVKIFGSNNKEKQTQ", "length": 165, "header": "tr|A0A0R4INS8-1|A0A0R4INS8_DANRE Isoform 1 of Retinoic acid receptor responder 3 OS=Danio rerio OX=7955 GN=rarres3 PE=3 SV=1 CANONICAL=A0A0R4INS8-1" }, "isoforms": [ { "isoform_ac": "A0A0R4INS8-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8/entry#A0A0R4INS8-1", "sequence": { "sequence": "MNKFDKKPQPGDLIEIFRGIYQHWAIYVGDGYVIHLVPPSEYAHAGANSMMSVLHERAKVKKENLYEVVGDHDYRINNFLDDKYEPRPIHEILQDAYSVLGQERSYSVFSGNCEHFVTELRYGKAHSRQVRKAVEMGVAAGISFGVLAYAVVKIFGSNNKEKQTQ", "length": 165, "header": "tr|A0A0R4INS8-1|A0A0R4INS8_DANRE Isoform 1 of Retinoic acid receptor responder 3 OS=Danio rerio OX=7955 GN=rarres3 PE=3 SV=1 CANONICAL=A0A0R4INS8-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Contrasted innate responses to two viruses in zebrafish: insights into the ancestral repertoire of vertebrate IFN-stimulated genes.", "journal": "J. Immunol.", "date": "2014", "authors": "Briolat Val\u00e9rie, Jouneau Luc, Carvalho Ralph, Palha Nuno, Langevin Christelle, Herbomel Philippe, Schwartz Olivier, Spaink Herman P, Levraud Jean-Pierre, Boudinot Pierre", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "reference": [ { "type": "PubMed", "id": "24683187", "url": "https://glygen.org/publication/PubMed/24683187" } ] }, { "title": "RFX transcription factors are essential for hearing in mice.", "journal": "Nat. Commun.", "date": "2015", "authors": "Elkon Ran, Milon Beatrice, Morrison Laura, Shah Manan, Vijayakumar Sarath, Racherla Manoj, Leitch Carmen C, Silipino Lorna, Hadi Shadan, Weiss-Gayet Mich\u00e8le, Barras Emmanu\u00e8le, Schmid Christoph D, Ait-Lounis Aouatef, Barnes Ashley, Song Yang, Eisenman David J, Eliyahu Efrat, Frolenkov Gregory I, Strome Scott E, Durand B\u00e9n\u00e9dicte, Zaghloul Norann A, Jones Sherri M, Reith Walter, Hertzano Ronna", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "reference": [ { "type": "PubMed", "id": "26469318", "url": "https://glygen.org/publication/PubMed/26469318" } ] }, { "title": "Organelle degradation in the lens by PLAAT phospholipases.", "journal": "Nature", "date": "2021", "authors": "Morishita H, Eguchi T, Tsukamoto S, Sakamaki Y, Takahashi S, Saito C, Koyama-Honda I, Mizushima N", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "reference": [ { "type": "PubMed", "id": "33854238", "url": "https://glygen.org/publication/PubMed/33854238" } ] } ], "pathway": [ { "id": "dre:767688", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:767688", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9NWW9-1", "protein_name": "Phospholipase A and acyltransferase 2", "gene_name": "PLAAT2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALARPRPRLGDLIEISRFGYAHWAIYVGDGYVVHLAPASEIAGAGAASVLSALTNKAIVKKELLSVVAGGDNYRVNNKHDDRYTPLPSNKIVKRAEELVGQELPYSLTSDNCEHFVNHLRYGVSRSDQVTGAVTTVGVAAGLLAAASLVGILLARSKRERQ", "length": 162 }, "evidence": [ { "id": "A0A0R4INS8", "url": "https://omabrowser.org/oma/group/A0A0R4INS8/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "phospholipase A2 activity", "id": "GO:0004623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004623", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "pmid": "" }, { "name": "phospholipase A1 activity", "id": "GO:0008970", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008970", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "pmid": "" }, { "name": "N-acyltransferase activity", "id": "GO:0016410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016410", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "N-acylphosphatidylethanolamine metabolic process", "id": "GO:0070292", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070292", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4INS8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4INS8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }