{ "uniprot_canonical_ac": "A0A0R4ING6-1", "uniprot_ac": "A0A0R4ING6", "uniprot_id": "A0A0R4ING6_DANRE", "mass": { "chemical_mass": 28034.0, "monoisotopic_mass": 28034.0 }, "refseq": { "ac": "NP_996973", "name": "guided entry of tail-anchored proteins factor CAMLG", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996973" }, "gene_names": [ { "name": "camlg", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6", "id": "A0A0R4ING6" }, { "name": "camlg", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996973", "id": "NP_996973" }, { "name": "zgc:77424", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996973", "id": "NP_996973" }, { "name": "zgc:77424", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6", "id": "A0A0R4ING6" } ], "protein_names": [ { "name": "Guided entry of tail-anchored proteins factor", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6/entry#names_and_taxonomy", "id": "A0A0R4ING6" }, { "name": "Calcium signal-modulating cyclophilin ligand", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6/entry#names_and_taxonomy", "id": "A0A0R4ING6" }, { "name": "guided entry of tail-anchored proteins factor CAMLG", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996973", "id": "NP_996973" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: SRR26395014.977452.1, SRR26395028.1278902.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA708828, SAMEA898399 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JBMGRA010000021.1. On Oct 2, 2012 this sequence version replaced NP_996973.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.", "evidence": [ { "database": "RefSeq", "id": "NP_996973", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996973" } ] }, { "annotation": "Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET1/WRB, acts as a membrane receptor for soluble GET3/TRC40, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. Required for the stability of GET1. Stimulates calcium signaling in T cells through its involvement in elevation of intracellular calcium. Essential for the survival of peripheral follicular B cells.", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ING6", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6#function" }, { "database": "UniProtKB", "id": "PIRNR018259", "url": "https://www.uniprot.org/uniprotkb/PIRNR018259#function" }, { "database": "UniProtKB", "id": "A0AB32TBB9", "url": "https://www.uniprot.org/uniprotkb/A0AB32TBB9#function" }, { "database": "UniProtKB", "id": "A0AB32TA88", "url": "https://www.uniprot.org/uniprotkb/A0AB32TA88#function" }, { "database": "UniProtKB", "id": "A0A8M2BHP5", "url": "https://www.uniprot.org/uniprotkb/A0A8M2BHP5#function" } ] } ], "disease": [ { "disease_id": "DOID:0051053", "recommended_name": { "id": "DOID:0051053", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0051053", "name": "congenital disorder of glycosylation type IIz", "description": "A congenital disorder of glycosylation type II that is characterized by poor overall growth, severe global developmental delay, seizures, contractures, hypotonia, spasticity, and brain imaging abnormalities and that has_material_basis_in homozygous mutation in the CAMLG gene on chromosome 5q23." }, "synonyms": [ { "id": "MONDO:0859357", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0859357", "name": "congenital disorder of glycosylation, type IIz", "description": "" }, { "id": "MIM:620201", "resource": "MIM", "url": "https://www.omim.org/entry/620201", "name": "Congenital disorder of glycosylation 2Z", "description": "Congenital disorder of glycosylation 2Z" } ], "unlinked_id_list": [], "evidence": [ { "id": "0051053", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0051053" } ] }, { "disease_id": "DOID:8692", "recommended_name": { "id": "DOID:8692", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8692", "name": "myeloid leukemia", "description": "A leukemia that is located_in myeloid tissue." }, "synonyms": [ { "id": "DOID:8692", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8692", "name": "Non-Lymphocytic Leukemia", "description": "" }, { "id": "DOID:8692", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8692", "name": "leukaemia myelogenous", "description": "" }, { "id": "DOID:8692", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8692", "name": "leukemia myelogenous", "description": "" }, { "id": "DOID:8692", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8692", "name": "myeloid granulocytic leukaemia", "description": "" }, { "id": "DOID:8692", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8692", "name": "myeloid granulocytic leukemia", "description": "" }, { "id": "DOID:8692", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8692", "name": "myeloid leukaemia", "description": "" } ], "unlinked_id_list": [ "DOID:8527" ], "evidence": [ { "id": "8692", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:8692" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ING6", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "camlg", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-040426-2407", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040426-2407", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000100409", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000100409", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "404622", "url": "https://www.ncbi.nlm.nih.gov/gene/404622", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR016719", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016719", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:404622", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:404622", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SFMKPPE", "url": "https://omabrowser.org/oma/group/SFMKPPE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4ING6", "url": "https://www.orthodb.org/?gene=A0A0R4ING6", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A8M2BHP5", "url": "https://www.orthodb.org/?gene=A0A8M2BHP5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15026", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15026", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15026:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15026:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF14963", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF14963", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_996973", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996973", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4ING6", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4ING6-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M2BHP5", "url": "https://www.uniprot.org/uniprotkb/A0A8M2BHP5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M2BHP5-1", "url": "https://www.uniprot.org/uniprotkb/A0A8M2BHP5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AB32TA88", "url": "https://www.uniprot.org/uniprotkb/A0AB32TA88", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AB32TA88-1", "url": "https://www.uniprot.org/uniprotkb/A0AB32TA88-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AB32TBB9", "url": "https://www.uniprot.org/uniprotkb/A0AB32TBB9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AB32TBB9-1", "url": "https://www.uniprot.org/uniprotkb/A0AB32TBB9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-040426-2407", "url": "https://zfin.org/ZDB-GENE-040426-2407", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MEAGQEPESARSAAQRRAEIRRRKLLNNSEDRMNRIVGFSKSDADSGERAGVGVLHLDLDHPEWSSSSKRASPADSGVCESVSERGVESAAVRSLSADGERSASPRRGLQAYLSRFDDAMKLRGQLANEKAAQDSGAQPEELDAFRIFRTTASVTFAVFVRIFVCQYLSIFAPFLTLELGFMGLHKYFPKVEKKPQTTMLTAALLLSGIPAEVISRSMDTYRKMSDVFSDLCVYFFSFIMSHELLLLFGSHTA", "length": 253, "header": "tr|A0A0R4ING6-1|A0A0R4ING6_DANRE Isoform 1 of Guided entry of tail-anchored proteins factor OS=Danio rerio OX=7955 GN=camlg PE=1 SV=1 CANONICAL=A0A0R4ING6-1" }, "isoforms": [ { "isoform_ac": "A0A0R4ING6-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6/entry#A0A0R4ING6-1", "sequence": { "sequence": "MEAGQEPESARSAAQRRAEIRRRKLLNNSEDRMNRIVGFSKSDADSGERAGVGVLHLDLDHPEWSSSSKRASPADSGVCESVSERGVESAAVRSLSADGERSASPRRGLQAYLSRFDDAMKLRGQLANEKAAQDSGAQPEELDAFRIFRTTASVTFAVFVRIFVCQYLSIFAPFLTLELGFMGLHKYFPKVEKKPQTTMLTAALLLSGIPAEVISRSMDTYRKMSDVFSDLCVYFFSFIMSHELLLLFGSHTA", "length": 253, "header": "tr|A0A0R4ING6-1|A0A0R4ING6_DANRE Isoform 1 of Guided entry of tail-anchored proteins factor OS=Danio rerio OX=7955 GN=camlg PE=1 SV=1 CANONICAL=A0A0R4ING6-1" }, "locus": {} }, { "isoform_ac": "A0A8M2BHP5-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6/entry#A0A8M2BHP5-1", "sequence": { "sequence": "MEAGQEPESARSAAQRRAEIRRRKLLNNSEDRMNRIVGFSKSDADSGERGVGVLHLDLDHPEWSSSSKRASPADSGVCESVSERGVESAAVRSLSADGERSASPRRGLQAYLSRFDDAMKLRGQLANEKAAQDSGAQPEELDAFRIFRTTASVTFAVFVRIFVCQYLSIFAPFLTLELGFMGLHKYFPKVEKKPQTTMLTAALLLSGIPAEVISRSMDTYRKMSDVFSDLCVYFFSFIMSHELLLLFGSHTA", "length": 252, "header": "tr|A0A8M2BHP5-1|A0A0R4ING6_DANRE Computationally mapped isoform of Guided entry of tail-anchored proteins factor OS=Danio rerio OX=7955 GN=camlg PE=1 SV=1 CANONICAL=A0A0R4ING6-1" }, "locus": {} }, { "isoform_ac": "A0AB32TA88-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6/entry#A0AB32TA88-1", "sequence": { "sequence": "MEAGQEPESARSAAQRRAEIRRRKLLNNSEDRMNRIVGFSKSDADSGERAGVGVLHLDHPEWSSSSKRASPADSGVCESVSERGVESAAVRSLSADGERSASPRRGLQAYLSRFDDAMKLRGQLANEKAAQDSGAQPEELDAFRIFRTTASVTFAVFVRIFVCQYLSIFAPFLTLELGFMGLHKYFPKVEKKPQTTMLTAALLLSGIPAEVISRSMDTYRKMSDVFSDLCVYFFSFIMSHELLLLFGSHTA", "length": 251, "header": "tr|A0AB32TA88-1|A0AB32TA88_DANRE Computationally mapped isoform of Guided entry of tail-anchored proteins factor OS=Danio rerio OX=7955 GN=camlg PE=1 SV=1 CANONICAL=A0A0R4ING6-1" }, "locus": {} }, { "isoform_ac": "A0AB32TBB9-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6/entry#A0AB32TBB9-1", "sequence": { "sequence": "MEAGQEPESARSAAQRRAEIRRRKLLNNSEDRMNRIVGFSKSDADSGERGVGVLHLDHPEWSSSSKRASPADSGVCESVSERGVESAAVRSLSADGERSASPRRGLQAYLSRFDDAMKLRGQLANEKAAQDSGAQPEELDAFRIFRTTASVTFAVFVRIFVCQYLSIFAPFLTLELGFMGLHKYFPKVEKKPQTTMLTAALLLSGIPAEVISRSMDTYRKMSDVFSDLCVYFFSFIMSHELLLLFGSHTA", "length": 250, "header": "tr|A0AB32TBB9-1|A0AB32TBB9_DANRE Computationally mapped isoform of Guided entry of tail-anchored proteins factor OS=Danio rerio OX=7955 GN=camlg PE=1 SV=1 CANONICAL=A0A0R4ING6-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A8M2BHP5", "url": "https://www.uniprot.org/uniprotkb/A0A8M2BHP5" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Number of inadvertent RNA targets for morpholino knockdown in Danio rerio is largely underestimated: evidence from the study of Ser/Arg-rich splicing factors.", "journal": "Nucleic Acids Res.", "date": "2017", "authors": "Joris Marine, Schloesser Marie, Baurain Denis, Hanikenne Marc, Muller Marc, Motte Patrick", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ING6", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6" } ], "reference": [ { "type": "PubMed", "id": "28934490", "url": "https://glygen.org/publication/PubMed/28934490" } ] } ], "pathway": [ { "id": "dre:404622", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:404622", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P49069-1", "protein_name": "Guided entry of tail-anchored proteins factor CAMLG", "gene_name": "CAMLG", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP", "length": 296 }, "evidence": [ { "id": "MGI:104728", "url": "https://alliancegenome.org/gene/MGI:104728#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-040426-2407", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040426-2407#orthology", "database": "AGR" }, { "id": "HGNC:1471", "url": "https://alliancegenome.org/gene/HGNC:1471#orthology", "database": "AGR" }, { "id": "A0A0R4ING6", "url": "https://omabrowser.org/oma/group/A0A0R4ING6/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P49070-1", "protein_name": "Guided entry of tail-anchored proteins factor CAMLG", "gene_name": "Camlg", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEPVPAATDGGERPATPSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGSEEENQTKSKPQDSDKLNSLSIPSVSKRVVLGDSVDGGGADQLGGVAEVRGTQLGDKLDSFIKAPECSSKDGAELRQRTRGDLTADPAQRASHHGLEQYLSRFEEAMKLRKQLISEKPSQEDGSTAEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKGEKKVKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGPEVP", "length": 294 }, "evidence": [ { "id": "MGI:104728", "url": "https://alliancegenome.org/gene/MGI:104728#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-040426-2407", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040426-2407#orthology", "database": "AGR" }, { "id": "HGNC:1471", "url": "https://alliancegenome.org/gene/HGNC:1471#orthology", "database": "AGR" }, { "id": "A0A0R4ING6", "url": "https://omabrowser.org/oma/group/A0A0R4ING6/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q6DGG9-1", "protein_name": "Guided entry of tail-anchored proteins factor CAMLG", "gene_name": "Camlg", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEPMPSATDGGDRSATPSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEENQTKSKPLDSDILNPLGVPSVSKRVVLGDSVDGGVTDYQPSGGADIRGAQLGDKLDSFIKAPECSSKDGVELRQRNRGDLTADSAPRGSHHGLEQYLSRFEEAMKLRKQLISEKPSQEDGRTTEEFDSFRIFRLVGCALLALVVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKGEKKVKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHEVLEYWGPEVP", "length": 295 }, "evidence": [ { "id": "MGI:104728", "url": "https://alliancegenome.org/gene/MGI:104728#orthology", "database": "AGR" }, { "id": "HGNC:1471", "url": "https://alliancegenome.org/gene/HGNC:1471#orthology", "database": "AGR" }, { "id": "A0A0R4ING6", "url": "https://omabrowser.org/oma/group/A0A0R4ING6/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q90700-1", "protein_name": "Guided entry of tail-anchored proteins factor", "gene_name": "CAMLG", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MEDGGGVGAASPGAPAGLSASQRRAELRRRKLLMNSEERINRIMGFHRPAAGKDDESHVESKLQHEQDKSNSLPLPSVSKRIVLGDSVSNVSGAADHAGSVGDLKGDKDLFSKTPQLVSEGTGELRHRNRGELPSEAAARPPRHGLEQYLSRFDEALKLRNQLMNEKPSQENGNAVEEFDSFRIFRLVGCALLAIAVRAFVCKYLSIFAPFLTLQLAYMGLSKYFPKSEKKVKTTVLTAALLLSGIPAEVISRSMDTYSKMGDVFTDLCVYFFTFIFCHELTLFFGSEVP", "length": 290 }, "evidence": [ { "id": "A0A0R4ING6", "url": "https://omabrowser.org/oma/group/A0A0R4ING6/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ING6", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6" } ], "pmid": "" }, { "name": "GET complex", "id": "GO:0043529", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043529", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ING6", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "tail-anchored membrane protein insertion into ER membrane", "id": "GO:0071816", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071816", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ING6", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ING6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 27, "end_pos": 29, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 27, "end_pos": 29 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }