{ "uniprot_canonical_ac": "A0A0R4IMZ7-1", "uniprot_ac": "A0A0R4IMZ7", "uniprot_id": "A0A0R4IMZ7_DANRE", "mass": { "chemical_mass": 36050.0, "monoisotopic_mass": 36050.0 }, "refseq": { "ac": "NP_001093559", "name": "lysine methyltransferase 5Ab", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093559" }, "gene_names": [ { "name": "kmt5ab", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7", "id": "A0A0R4IMZ7" }, { "name": "kmt5ab", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093559", "id": "NP_001093559" }, { "name": "setd8b; wu:fc23f12; zgc:171649", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093559", "id": "NP_001093559" }, { "name": "setd8b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7", "id": "A0A0R4IMZ7" }, { "name": "wu:fc23f12", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7", "id": "A0A0R4IMZ7" }, { "name": "zgc:171649", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7", "id": "A0A0R4IMZ7" } ], "protein_names": [ { "name": "[histone H4]-lysine(20) N-methyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7/entry#names_and_taxonomy", "id": "A0A0R4IMZ7" }, { "name": "2.1.1.361", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7/entry#names_and_taxonomy", "id": "A0A0R4IMZ7" }, { "name": "SET domain containing 8b; SET domain containing (lysine methyltransferase) 8b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093559", "id": "NP_001093559" }, { "name": "lysine methyltransferase 5Ab", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093559", "id": "NP_001093559" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: BC151909.1, GDQH01026878.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505378, SAMEA3505382 [ECO:0000348] ##Evidence-Data-END## PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JBMGRA010000005.1. On Jun 25, 2025 this sequence version replaced NP_001093559.1.", "evidence": [ { "database": "RefSeq", "id": "NP_001093559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093559" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "kmt5ab", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-071004-17", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-071004-17", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000104114", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000104114", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd10528", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10528", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100004770", "url": "https://www.ncbi.nlm.nih.gov/gene/100004770", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001214", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001214", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016858", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016858", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046341", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046341", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047266", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047266", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051760", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051760", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:100004770", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100004770", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SESCKGQ", "url": "https://omabrowser.org/oma/group/SESCKGQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IMZ7", "url": "https://www.orthodb.org/?gene=A0A0R4IMZ7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46167", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46167", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46167:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46167:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00856", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00856", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001093559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093559", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "51736", "url": "https://www.rhea-db.org/rhea/51736", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "60344", "url": "https://www.rhea-db.org/rhea/60344", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IMZ7-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-071004-17", "url": "https://zfin.org/ZDB-GENE-071004-17", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MGKGKKSSSAKRRPADINVMEKTDKEAKENKQVKPTTAQGQPTIESCLNLKKPIRNKPLSPVLDDNSTKKANKQSEAKDADELNVSKQEEPVEQIIICGHNEQTAVPHKASETRKQTKSGQRTNREKSTDRKLKSKESLPNHKVTDYFPVRRSCRKSKAELKCEKQRHIEDLIKNDVEEGLKVKCIDGKGRGVFADRLFQKDQFVVEYHGDLIEIADAKARESEYAQDPSTGCYMYYFRYHDRTYCVDATKETERLGRLINHSKNGNLQTKLHEIDGTPHLIFLASRDIRADEELLYDYGDRSKEAIAAHPWLKH", "length": 315, "header": "tr|A0A0R4IMZ7-1|A0A0R4IMZ7_DANRE Isoform 1 of [histone H4]-lysine(20) N-methyltransferase OS=Danio rerio OX=7955 GN=kmt5ab PE=1 SV=1 CANONICAL=A0A0R4IMZ7-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IMZ7-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7/entry#A0A0R4IMZ7-1", "sequence": { "sequence": "MGKGKKSSSAKRRPADINVMEKTDKEAKENKQVKPTTAQGQPTIESCLNLKKPIRNKPLSPVLDDNSTKKANKQSEAKDADELNVSKQEEPVEQIIICGHNEQTAVPHKASETRKQTKSGQRTNREKSTDRKLKSKESLPNHKVTDYFPVRRSCRKSKAELKCEKQRHIEDLIKNDVEEGLKVKCIDGKGRGVFADRLFQKDQFVVEYHGDLIEIADAKARESEYAQDPSTGCYMYYFRYHDRTYCVDATKETERLGRLINHSKNGNLQTKLHEIDGTPHLIFLASRDIRADEELLYDYGDRSKEAIAAHPWLKH", "length": 315, "header": "tr|A0A0R4IMZ7-1|A0A0R4IMZ7_DANRE Isoform 1 of [histone H4]-lysine(20) N-methyltransferase OS=Danio rerio OX=7955 GN=kmt5ab PE=1 SV=1 CANONICAL=A0A0R4IMZ7-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Genome-wide survey and developmental expression mapping of zebrafish SET domain-containing genes.", "journal": "PLoS ONE", "date": "2008", "authors": "Sun XJ, Xu PF, Zhou T, Hu M, Fu CT, Zhang Y, Jin Y, Chen Y, Chen SJ, Huang QH, Liu TX, Chen Z", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "reference": [ { "type": "PubMed", "id": "18231586", "url": "https://glygen.org/publication/PubMed/18231586" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Gonad differentiation in zebrafish is regulated by the canonical Wnt signaling pathway.", "journal": "Biol. Reprod.", "date": "2014", "authors": "Sreenivasan Rajini, Jiang Junhui, Wang Xingang, B\u00e1rtfai Rich\u00e1rd, Kwan Hsiao Yuen, Christoffels Alan, Orb\u00e1n L\u00e1szl\u00f3", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "reference": [ { "type": "PubMed", "id": "24174574", "url": "https://glygen.org/publication/PubMed/24174574" } ] }, { "title": "A network of epigenetic regulators guides developmental haematopoiesis in vivo.", "journal": "Nat. Cell Biol.", "date": "2013", "authors": "Huang Hsuan-Ting, Kathrein Katie L, Barton Abby, Gitlin Zachary, Huang Yue-Hua, Ward Thomas P, Hofmann Oliver, Dibiase Anthony, Song Anhua, Tyekucheva Svitlana, Hide Winston, Zhou Yi, Zon Leonard I", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "reference": [ { "type": "PubMed", "id": "24240475", "url": "https://glygen.org/publication/PubMed/24240475" } ] }, { "title": "Role of annexin gene and its regulation during zebrafish caudal fin regeneration.", "journal": "Wound Repair Regen.", "date": "2016", "authors": "Saxena Sandeep, Purushothaman Sruthi, Meghah Vuppalapaty, Bhatti Bhawna, Poruri Akhila, Meena Lakshmi Mula G, Sarath Babu Nukala, Narasimha Murthy Ch Lakshmi, Mandal Komal K, Kumar Arvind, Idris Mohammed M", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "reference": [ { "type": "PubMed", "id": "26972483", "url": "https://glygen.org/publication/PubMed/26972483" } ] }, { "title": "Mechanism of toxic effects of Nano-ZnO on cell cycle of zebrafish (Danio rerio).", "journal": "Chemosphere", "date": "2019", "authors": "Hou Jing, Liu Haiqiang, Zhang Siyi, Liu Xinhui, Hayat Tasawar, Alsaedi Ahmed, Wang Xiangke", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "reference": [ { "type": "PubMed", "id": "31078877", "url": "https://glygen.org/publication/PubMed/31078877" } ] }, { "title": "Foxm1 regulates cardiomyocyte proliferation in adult zebrafish after cardiac injury.", "journal": "Development", "date": "2023", "authors": "Zuppo Daniel A, Missinato Maria A, Santana-Santos Lucas, Li Guang, Benos Panayiotis V, Tsang Michael", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "reference": [ { "type": "PubMed", "id": "36846912", "url": "https://glygen.org/publication/PubMed/36846912" } ] } ], "pathway": [ { "id": "dre:100004770", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100004770", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JW37-1", "protein_name": "N-lysine methyltransferase KMT5A", "gene_name": "Kmt5al2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "IFLPSNRSNLFAGQSKICAVMSPNKWSGIRSPLQEENSVVHHEVKFPGKPLAGILRKGEEKRNARNVIRSTVKSDEQKSKGTRRGPRAPFPNQKPEAKAPPKAPPPSRDYTNVAVAKQAQKKPLKGKQAPREKSQGKTQQNRKLTDFHPVRRSSRKSKAELRSEERKKIDELIESGKEEGMKVDLIDGKGRGVIATKRFSRGDFVVEYHGDLIEITDAKKREALYAQNPSTGCYMYYFQYLRKTYCVDATQETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH", "length": 315 }, "evidence": [ { "id": "HGNC:29489", "url": "https://alliancegenome.org/gene/HGNC:29489#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A8I5ZQS7-1", "protein_name": "N-lysine methyltransferase KMT5A", "gene_name": "Kmt5a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSPNKCSGMRSPLQEENSVAHHEVKCPGKPLAGIYRKREEKRNAGNVIRSAVKSEEQKSKDTRRGPLAPFPNQKPEATEPPKTPPPSCDSTSVAVAKQALKKPLKGKQAPRKKSQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKKIDELIESGKEEGMKIDLIDGKGRGVIATKRFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATQETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH", "length": 295 }, "evidence": [ { "id": "HGNC:29489", "url": "https://alliancegenome.org/gene/HGNC:29489#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q071E0-1", "protein_name": "N-lysine methyltransferase KMT5A-A", "gene_name": "kmt5aa", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MFPAVNEIKVQTWRRDQRGECPRRSAQCRLFSCAHRECAPAARSLENRGPENRTARPEATMSGDVLCNGHSAFHRLLKHSSSRTHEALVVKIIQENKNTPLFCTAPEPRRDSGVNGEFLLNSAELQDEQTLPLHCIHSAADITSSKHRKPARRKVKRSTKRAAESKSPANRKVTDYFPIRRSSRKSKSELKYEEKQHIDTLISNGIEDGMMVRFIEGKGRGVFATQPFQKGQYVVEYHGDLLQITDAKQREALYAQDPSTGCYMYYFQYLSKTYCVDATKESDRLGRLINHSKNGNCQTKLHAIAGKPHLILVASRDIQEGEELLYDYGDRSKSSIEAHPWLKH", "length": 344 }, "evidence": [ { "id": "HGNC:29489", "url": "https://alliancegenome.org/gene/HGNC:29489#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q2YDW7-1", "protein_name": "N-lysine methyltransferase KMT5A", "gene_name": "Kmt5a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARGRKMCKPRAVEAAAAAVAATAPGPEMVEQRGPGRPRSDGENVFAGQSKIYAYMSPNKCSAMRSPLQEENSVAHHEVKCPGKPLAGIYRKREEKRNTGNVIRSAVKSDEQKSKDTRRGPLAPFPNQKSEAAEPPKTPPPSCDSTNVAVAKQALKKSLKGKQAPRKKSQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKKNELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYVQDPSTGCYMYYFQYLSKTYCVDATQETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH", "length": 349 }, "evidence": [ { "id": "HGNC:29489", "url": "https://alliancegenome.org/gene/HGNC:29489#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NQR1-1", "protein_name": "N-lysine methyltransferase KMT5A", "gene_name": "KMT5A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGEGGAAAALVAAAAAAAAAAAAVVAGQRRRRLGRRARCHGPGRAAGGKMSKPCAVEAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH", "length": 393 }, "evidence": [ { "id": "HGNC:29489", "url": "https://alliancegenome.org/gene/HGNC:29489#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-071004-17", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-071004-17#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9VFK6-1", "protein_name": "Histone-lysine N-methyltransferase Set8", "gene_name": "Set8", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MIMVRRRQRPAKEAASSSSGGASSGSGIPVDQALPLNVAGNLLEDQYFASPKRKDCRLMKVTQNGQLPEATMMAHNKDNKAGRTIGVPLATRSQTRTIENFFKANAAAKDSQKTIHTEEQLNLGNQELKLDDEELNGQIKLDDEVLKLADKQINENLPFADEVDAKAEQKLMDEELQQVVEELLFDGSSRASSNSPFYQHDMDVMQEIQQTPEIPHIKKVTEPLEGLGSLADFQTHRSALRDSHSSTHSSSTDNIFLQEPVLTLDIDRTPTKASSIKINRSFELAGAVFSSPPSVLNACLNGRFNQIVSLNGQKEALDLPHFDLDQHDSSSCDSGVACGLTANTESPAGQPRRRKPATPHRILCPSPIKTALKVTGGICKVGSADPLSPRKSPRKLPTTTAAVAACKSRRRLNQPKPQAPYQPQLQKPPSQQQQQQQDDIVVVLDDDDDEGDDEDDVRALIKAAEERENQNKAPATANSNKAGMKTMLKPAPVKSKTKSKGPTKGQPPLPLAATNGNREMTDFFPVRRSVRKTKTAVKEEWMRGLEQAVLEERCDGLQVRHFMGKGRGVVADRPFKRNEFVVEYVGDLISIGEAAEREKRYALDENAGCYMYYFKHKSQQYCIDATVDTGKLGRLINHSRAGNLMTKVVLIKQRPHLVLLAKDDIEPGEELTYDYGDRSKESLLHHPWLAF", "length": 691 }, "evidence": [ { "id": "HGNC:29489", "url": "https://alliancegenome.org/gene/HGNC:29489#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "regulation of DNA damage response, signal transduction by p53 class mediator", "id": "GO:0043516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043516", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "pmid": "" }, { "name": "methylation", "id": "GO:0032259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "pmid": "" }, { "name": "polytene chromosome", "id": "GO:0005700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005700", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "histone H4K20 methyltransferase activity", "id": "GO:0042799", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042799", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "pmid": "" }, { "name": "histone H4K20 monomethyltransferase activity", "id": "GO:0140944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140944", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMZ7", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 261, "end_pos": 263, "annotation": "n_glycosylation_sequon" }, { "start_pos": 66, "end_pos": 68, "annotation": "n_glycosylation_sequon" }, { "start_pos": 84, "end_pos": 86, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "51736", "name": "", "equation": "L-lysyl-[protein] + S-adenosyl-L-methionine = N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5BJI7-1", "Q5RGL7-1", "Q6P2A1-1", "Q071E0-1", "Q6DHG0-1", "A0A0R4IMZ7-1", "A5WVX1-1", "Q08C84-1" ], "evidence": [ { "id": "51736", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/51736" } ] }, { "id": "60344", "name": "", "equation": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5U3H2-1", "Q6P2A1-1", "Q071E0-1", "A0A0R4IMZ7-1" ], "evidence": [ { "id": "60344", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/60344" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0R4IMZ7", "gene_name": "kmt5ab", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine + H(+).", "evidence": [ { "id": "A0A0R4IMZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "A0A0R4IMZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMZ7" } ] } ] }, { "uniprot_ac": "A5WVX1", "gene_name": "mettl13", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "A5WVX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A5WVX1" } ] } ] }, { "uniprot_ac": "Q071E0", "gene_name": "kmt5aa", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q071E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q071E0" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine + H(+).", "evidence": [ { "id": "Q071E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q071E0" } ] } ] }, { "uniprot_ac": "Q08C84", "gene_name": "smyd4", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q08C84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q08C84" } ] } ] }, { "uniprot_ac": "Q5BJI7", "gene_name": "smyd2a", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine + 3 H(+).", "evidence": [ { "id": "Q5BJI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q5BJI7" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "Q5BJI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q5BJI7" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q5BJI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q5BJI7" } ] } ] }, { "uniprot_ac": "Q5RGL7", "gene_name": "smyd2b", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine + 3 H(+).", "evidence": [ { "id": "Q5RGL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q5RGL7" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "Q5RGL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q5RGL7" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q5RGL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q5RGL7" } ] } ] }, { "uniprot_ac": "Q5U3H2", "gene_name": "kmt5b", "activity": [ { "ec_number": "2.1.1.362", "activity": "N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = N(6),N(6)-dimethyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine + H(+).", "evidence": [ { "id": "Q5U3H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q5U3H2" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine + H(+).", "evidence": [ { "id": "Q5U3H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q5U3H2" } ] } ] }, { "uniprot_ac": "Q6DHG0", "gene_name": "setd7", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine + H(+).", "evidence": [ { "id": "Q6DHG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6DHG0" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q6DHG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6DHG0" } ] } ] }, { "uniprot_ac": "Q6P2A1", "gene_name": "prdm9", "activity": [ { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine + 3 H(+).", "evidence": [ { "id": "Q6P2A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6P2A1" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q6P2A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6P2A1" } ] }, { "ec_number": "2.1.1.355", "activity": "L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-methionine = N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-homocysteine + 3 H(+).", "evidence": [ { "id": "Q6P2A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6P2A1" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine + 3 H(+).", "evidence": [ { "id": "Q6P2A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6P2A1" } ] }, { "ec_number": "2.1.1.362", "activity": "N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = N(6),N(6)-dimethyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine + H(+).", "evidence": [ { "id": "Q6P2A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6P2A1" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine + H(+).", "evidence": [ { "id": "Q6P2A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6P2A1" } ] } ] } ], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "2.1.1.361", "ec_name": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine + H(+).", "evidence": [ { "id": "2.1.1.361", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.1.1.361" }, { "id": "2.1.1.361", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.1.361" } ] } ], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 261, "end_pos": 263 }, { "start_pos": 66, "end_pos": 68 }, { "start_pos": 84, "end_pos": 86 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }