{ "uniprot_canonical_ac": "A0A0R4IMG2-1", "uniprot_ac": "A0A0R4IMG2", "uniprot_id": "A0A0R4IMG2_DANRE", "mass": { "chemical_mass": 57098.0, "monoisotopic_mass": 57098.0 }, "refseq": { "ac": "NP_956135", "name": "glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease IIID), b precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_956135" }, "gene_names": [ { "name": "gnsb", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2", "id": "A0A0R4IMG2" }, { "name": "gns; wu:fi20h10; zgc:55370", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_956135", "id": "NP_956135" }, { "name": "gnsb", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_956135", "id": "NP_956135" }, { "name": "gns", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2", "id": "A0A0R4IMG2" }, { "name": "wu:fi20h10", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2", "id": "A0A0R4IMG2" }, { "name": "zgc:55370", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2", "id": "A0A0R4IMG2" } ], "protein_names": [ { "name": "N-acetylglucosamine-6-sulfatase", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2/entry#names_and_taxonomy", "id": "A0A0R4IMG2" }, { "name": "3.1.6.14", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2/entry#names_and_taxonomy", "id": "A0A0R4IMG2" }, { "name": "Glucosamine-6-sulfatase", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2/entry#names_and_taxonomy", "id": "A0A0R4IMG2" }, { "name": "glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease IIID), b precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_956135", "id": "NP_956135" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: BC045323.1, GDQH01000390.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505392, SAMEA4476731 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JBMGRA010000010.1. On or before Feb 25, 2016 this sequence version replaced XP_005155531.1, NP_956135.1. Sequence Note: This RefSeq record was created from genomic sequence data because no single transcript from the reference genome strain was available for the full length of the gene. The extent of this transcript is supported by partial transcript alignments and orthologous alignments.", "evidence": [ { "database": "RefSeq", "id": "NP_956135", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_956135" } ] } ], "disease": [ { "disease_id": "DOID:0111402", "recommended_name": { "id": "DOID:0111402", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111402", "name": "mucopolysaccharidosis type IIID", "description": "A mucopolysaccharidosis III that has_material_basis_in homozygous or compound heterozygous mutation in GNS on chromosome 12q14.3." }, "synonyms": [ { "id": "DOID:0111402", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111402", "name": "GNS deficiency", "description": "" }, { "id": "DOID:0111402", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111402", "name": "MPS IIID", "description": "" }, { "id": "DOID:0111402", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111402", "name": "MPS3D", "description": "" }, { "id": "DOID:0111402", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111402", "name": "Mucopolysaccharidosis type 3D", "description": "" }, { "id": "DOID:0111402", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111402", "name": "N-acetylglucosamine-6-sulfatase deficiency", "description": "" }, { "id": "DOID:0111402", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111402", "name": "Sanfilippo syndrome D", "description": "" }, { "id": "DOID:0111402", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111402", "name": "Sanfilippo syndrome type D", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "mucopolysaccharidosis type 3D", "description": "A rare autosomal recessive lysosomal storage disease caused by deficiency of the enzyme N-acetylglucosamine-6-sulfatase. It is characterized by behavioral changes, sleep disturbances and mental developmental delays." }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "GNS deficiency", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "MPS III D", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "MPS3D", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "MPSIIID", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "Sanfilippo D", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "Sanfilippo syndrome D", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "Sanfilippo syndrome type D", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "glucosamine N-acetyl-6-sulfatase deficiency", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "mucopolysaccharidosis type 3D", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "mucopolysaccharidosis type IIID", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "MPS 3D", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "MPS IIID", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "Mucopoly-saccharidosis type 3D", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "N-acetylglucosamine-6-sulfatase deficiency", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "N-acetylglucosamine-6-sulfate sulfatase deficiency", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "mucopolysaccharidosis, type 3D", "description": "" }, { "id": "MONDO:0009658", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009658", "name": "mucopolysaccharidosis, type IIID", "description": "" }, { "id": "MIM:252940", "resource": "MIM", "url": "https://www.omim.org/entry/252940", "name": "Mucopolysaccharidosis 3D", "description": "Mucopolysaccharidosis 3D" } ], "unlinked_id_list": [], "evidence": [ { "id": "0111402", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111402" } ] }, { "disease_id": "DOID:12801", "recommended_name": { "id": "DOID:12801", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12801", "name": "mucopolysaccharidosis III", "description": "A mucopolysaccharidosis characterized by a deficiency of the lysosomal enzyme resulting in incomplete breakdown of the heparan sulfate sugar chain." }, "synonyms": [ { "id": "DOID:12801", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12801", "name": "Mucopolysaccharidosis, MPS-III", "description": "" }, { "id": "DOID:12801", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12801", "name": "N-sulphoglucosamine sulphohydrolase deficiency", "description": "" }, { "id": "DOID:12801", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12801", "name": "Sanfilippo's syndrome", "description": "" }, { "id": "DOID:12801", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12801", "name": "heparan sulfate sulfatase deficiency", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "12801", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:12801" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMG2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "gnsb", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-030131-5846", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-5846", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "cd16147", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16147", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "327635", "url": "https://www.ncbi.nlm.nih.gov/gene/327635", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000917", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000917", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012251", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012251", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:327635", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:327635", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GMRFDNC", "url": "https://omabrowser.org/oma/group/GMRFDNC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IMG2", "url": "https://www.orthodb.org/?gene=A0A0R4IMG2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43108", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43108", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43108:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43108:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00884", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00884", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_956135", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_956135", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IMG2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IMG2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M9QGE4", "url": "https://www.uniprot.org/uniprotkb/A0A8M9QGE4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M9QGE4-1", "url": "https://www.uniprot.org/uniprotkb/A0A8M9QGE4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-030131-5846", "url": "https://zfin.org/ZDB-GENE-030131-5846", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MRSSPPGQWSCGCPLKLLVLFFFFFTCAFSSKNNIILILTDDQDEQMGGMTPMKKTRELIGDAGATFSNAFTSTPLCCPSRSSFLSGRYPHNHLVHNNSVEGNCSSAAWQKTAEPFAFPVYLNKMRYQTFYCGKYLNQYGSKDAGGVAHVPPGWDQWHALVGNSKYYNYTLSVNGKEEKHGDSYEKDYLTDLVLNRSLHFLEERSPSHPFFMMLCPPAPHSPWTAAPQYSGSFSGVKAPRNGSFNKPGTDKHWLLRQPANPMPNSSIDYLDNAFRRRWQTLLSVDDLVERLLKKLDSVKELDNTYIFYTSDHGYHTGQFSLPIDKRQLYEFDIRIPLLVRGPGIKAKQTLQSPVLNIDLPMTILDIAGVNLSTVNMDGQSFLPQMAPSLRNGTERPFFLVEYTGEGYSSQDPSCPKLGPGLAECFPDCVCEDAFNNTYACVRTLKGANLQYCEFADNEAFVEMYNLTADPHQLENIVKKVDPSLLQIMNQRLIKLQSCAGDTCRNIR", "length": 507, "header": "tr|A0A0R4IMG2-1|A0A0R4IMG2_DANRE Isoform 1 of N-acetylglucosamine-6-sulfatase OS=Danio rerio OX=7955 GN=gnsb PE=1 SV=1 CANONICAL=A0A0R4IMG2-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IMG2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2/entry#A0A0R4IMG2-1", "sequence": { "sequence": "MRSSPPGQWSCGCPLKLLVLFFFFFTCAFSSKNNIILILTDDQDEQMGGMTPMKKTRELIGDAGATFSNAFTSTPLCCPSRSSFLSGRYPHNHLVHNNSVEGNCSSAAWQKTAEPFAFPVYLNKMRYQTFYCGKYLNQYGSKDAGGVAHVPPGWDQWHALVGNSKYYNYTLSVNGKEEKHGDSYEKDYLTDLVLNRSLHFLEERSPSHPFFMMLCPPAPHSPWTAAPQYSGSFSGVKAPRNGSFNKPGTDKHWLLRQPANPMPNSSIDYLDNAFRRRWQTLLSVDDLVERLLKKLDSVKELDNTYIFYTSDHGYHTGQFSLPIDKRQLYEFDIRIPLLVRGPGIKAKQTLQSPVLNIDLPMTILDIAGVNLSTVNMDGQSFLPQMAPSLRNGTERPFFLVEYTGEGYSSQDPSCPKLGPGLAECFPDCVCEDAFNNTYACVRTLKGANLQYCEFADNEAFVEMYNLTADPHQLENIVKKVDPSLLQIMNQRLIKLQSCAGDTCRNIR", "length": 507, "header": "tr|A0A0R4IMG2-1|A0A0R4IMG2_DANRE Isoform 1 of N-acetylglucosamine-6-sulfatase OS=Danio rerio OX=7955 GN=gnsb PE=1 SV=1 CANONICAL=A0A0R4IMG2-1" }, "locus": {} }, { "isoform_ac": "A0A8M9QGE4-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2/entry#A0A8M9QGE4-1", "sequence": { "sequence": "MKKTRELIGDAGATFSNAFTSTPLCCPSRSSFLSGRYPHNHLVHNNSVEGNCSSAAWQKTAEPFAFPVYLNKMRYQTFYCGKYLNQYGSKDAGGVAHVPPGWDQWHALVGNSKYYNYTLSVNGKEEKHGDSYEKDYLTDLVLNRSLHFLEERSPSHPFFMMLCPPAPHSPWTAAPQYSGSFSGVKAPRNGSFNKPGTDKHWLLRQPANPMPNSSIDYLDNAFRRRWQTLLSVDDLVERLLKKLDSVKELDNTYIFYTSDHGYHTGQFSLPIDKRQLYEFDIRIPLLVRGPGIKAKQTLQSPVLNIDLPMTILDIAGVNLSTVNMDGQSFLPQMAPSLRNGTERPFFLVEYTGEGYSSQDPSCPKLGPGLAECFPDCVCEDAFNNTYACVRTLKGANLQYCEFADNEAFVEMYNLTADPHQLENIVKKVDPSLLQIMNQRLIKLQSCAGDTCRNIR", "length": 455, "header": "tr|A0A8M9QGE4-1|A0A8M9QGE4_DANRE Computationally mapped isoform of N-acetylglucosamine-6-sulfatase OS=Danio rerio OX=7955 GN=gnsb PE=1 SV=1 CANONICAL=A0A0R4IMG2-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "40044042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40044042" }, { "id": "A0A0R4IMG2", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A0A0R4IMG2" } ], "filter_code": "00000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxx.xxxxx.xxxxx" } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A comparative map of the zebrafish genome.", "journal": "Genome Res.", "date": "2000", "authors": "Woods I G, Kelly P D, Chu F, Ngo-Hazelett P, Yan Y L, Huang H, Postlethwait J H, Talbot W S", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMG2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2" } ], "reference": [ { "type": "PubMed", "id": "11116086", "url": "https://glygen.org/publication/PubMed/11116086" } ] }, { "title": "The zebrafish gene map defines ancestral vertebrate chromosomes.", "journal": "Genome Res.", "date": "2005", "authors": "Woods Ian G, Wilson Catherine, Friedlander Brian, Chang Patricia, Reyes Daengnoy K, Nix Rebecca, Kelly Peter D, Chu Felicia, Postlethwait John H, Talbot William S", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMG2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2" } ], "reference": [ { "type": "PubMed", "id": "16109975", "url": "https://glygen.org/publication/PubMed/16109975" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMG2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Upregulation of Protein O-GlcNAcylation Levels Promotes Zebrafish Fin Regeneration.", "journal": "Molecular & cellular proteomics : MCP", "date": "2025-04", "authors": "Jia Liyuan, Zheng Hanxue, Feng Juantao, Ding Yi, Sun Xiaotian, Yu Yuan, Hao Xue, Wang Junxiang, Zhang Xinyu, Tian Yuanfeng, Chen Fulin, Cui Jihong", "evidence": [ { "database": "O-GlcNAc Database", "id": "A0A0R4IMG2", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A0A0R4IMG2" } ], "reference": [ { "type": "PubMed", "id": "40044042", "url": "https://glygen.org/publication/PubMed/40044042" } ] } ], "pathway": [ { "id": "dre:327635", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:327635", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P15586-1", "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "GNS", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL", "length": 552 }, "evidence": [ { "id": "HGNC:4422", "url": "https://alliancegenome.org/gene/HGNC:4422#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-030131-5846", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-5846#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q32KJ5-1", "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "Gns", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRLPSAAGPGPGCPSRLPALLLLPLLSGCLGLVGAARRPNVLLLLTDDQDAELGGMTPLKKTKALIGEKGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPYTFPAILKLVCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARRHGENYSVDYLTDVLANLSLDFLDYKSNSEPFFMMISTPAPHSPWTAAPQYQKAFPNVIAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIKFLDDAFRRRWQTLLSVDDLVEKLVKRLDSTGELDNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVSNIDLGPTILDLAGYDLNKTQMDGTSLLPILKGDGNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTLSSMWNLQYCEFDDQEVFVEVYNITADPDQITNIAKSIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDLRLMFSNHGSIRMRRFSKHPL", "length": 544 }, "evidence": [ { "id": "HGNC:4422", "url": "https://alliancegenome.org/gene/HGNC:4422#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q4V902-1", "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "gnsa", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MVSAPLVLLHCIIVICVTLHCVNLAAAKTNPKPNIVLILTDDLDVSIGGMIPLVKTKKLIGDAGITFTNAFVASPLCCPSRASILTGKYPHNHHVVNNTLEGNCSSTAWQKGQEPDAFPAFLQKHAAYQTFFAGKYLNEYGSKKAGGVEHVPLGWDHWFALERNSKYYNYTLSVNGRAQRHGQNYSEDYLTDVLANVSIDFLENKSNRRPFFMMVSTPAPHSPWTAAPQYDSSFPDLKAPRDPNFNIHGKDKHWLIRQAKTPMSNASVEFLDNAYRKRWRTLLSVDDLVEKLVRKLDIRGELSNTYVIFTSDNGYHTGQFSLPMDKRQLYEFDIRVPLLVRGPNIKPNQTSPLPIANVDLGPTILDIAGYNVNDTQMDGMSFLPIMVGELNSSVWRSDVLVEYEGEGRNVSDPACPLLGPGVSECFPDCVCEDAYNNTYACVRTVSPNANLQYCEFDDNEVFVEVYNLTSDPFQLSNIAKSIDQEVLEKMNHRLMMLQSCSGRSCRTPGVYDSRFRFDPRFMFSSLVPHRNKRRQMLK", "length": 538 }, "evidence": [ { "id": "HGNC:4422", "url": "https://alliancegenome.org/gene/HGNC:4422#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q5BIL9-1", "protein_name": "SD21168p", "gene_name": "Gns", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MISLAPLIILVLACLGNTASEKLPNILLILSDDQDVELRGMFPMEHTIEMLGFGGALFHNAYTPSPICCPARTSLLTGMYAHNHGTRNNSVSGGCYGPHWRRALEPRALPYILQQHGYNTFFGGKYLNQYWGAGDVPKGWNHFYGLHGNSRYYNYTLRENSGNVHYESTYLTDLLRDRAADFLRNATQSSEPFFAMVAPPAAHEPFTPAPRHEGVFSHIEALRTPSFNQVKQDKHWLVRAARRLPNETINTIDTYFQKRWETLLAVDELVVTLMGVLNDTQSLENTYIIYTSDNGYHVGQFAQPFDKRQPYETDINVPLLIRGPGIAPESHIDTAVSLVDLAPTILAWADIDTPSYMDGQSFHELLLNKRRRVPFFERSLLIEYWGEGTLATFNPECPWPEKDRLAQCTPAADCHCQDAWNNTYACLRNIRHREDRIYCEFRDNENFLEAYDLQLDPFQMTNIAYDLLPIERALYSLRLKNLTQCSGHSCFV", "length": 492 }, "evidence": [ { "id": "HGNC:4422", "url": "https://alliancegenome.org/gene/HGNC:4422#orthology", "database": "AGR" }, { "id": "A0A0R4IMG2", "url": "https://omabrowser.org/oma/group/A0A0R4IMG2/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8BFR4-1", "protein_name": "N-acetylglucosamine-6-sulfatase", "gene_name": "Gns", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRLPSAAGPRPGRPRRLPALLLLPLLGGCLGLVGAARRPNVLLLLTDDQDAELGGMTPLKKTKALIGEKGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKAWQKIQEPYTFPAILKSVCGYQTFFAGKYLNEYGAPDAGGLEHIPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANLSLDFLDYKSNSEPFFMMISTPAPHSPWTAAPQYQKAFQNVIAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIRFLDDAFRRRWQTLLSVDDLVEKLVKRLDSTGELDNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVSNIDLGPTILDLAGYDLNKTQMDGMSLLPILKGDRNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTLSSLWNLQYCEFDDQEVFVEVYNITADPDQITNIAKSIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDLRLMFNSHGSVRTRRFSKHPL", "length": 544 }, "evidence": [ { "id": "HGNC:4422", "url": "https://alliancegenome.org/gene/HGNC:4422#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "N-acetylglucosamine-6-sulfatase activity", "id": "GO:0008449", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008449", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMG2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMG2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2" } ], "pmid": "" }, { "name": "glycosaminoglycan binding", "id": "GO:0005539", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005539", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMG2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMG2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "glycosaminoglycan metabolic process", "id": "GO:0030203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030203", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IMG2", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IMG2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 103, "end_pos": 105, "annotation": "n_glycosylation_sequon" }, { "start_pos": 168, "end_pos": 170, "annotation": "n_glycosylation_sequon" }, { "start_pos": 195, "end_pos": 197, "annotation": "n_glycosylation_sequon" }, { "start_pos": 241, "end_pos": 243, "annotation": "n_glycosylation_sequon" }, { "start_pos": 264, "end_pos": 266, "annotation": "n_glycosylation_sequon" }, { "start_pos": 370, "end_pos": 372, "annotation": "n_glycosylation_sequon" }, { "start_pos": 391, "end_pos": 393, "annotation": "n_glycosylation_sequon" }, { "start_pos": 435, "end_pos": 437, "annotation": "n_glycosylation_sequon" }, { "start_pos": 465, "end_pos": 467, "annotation": "n_glycosylation_sequon" }, { "start_pos": 97, "end_pos": 99, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "3.1.6.14", "ec_name": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate.", "evidence": [ { "id": "3.1.6.14", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.6.14" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 103, "end_pos": 105 }, { "start_pos": 168, "end_pos": 170 }, { "start_pos": 195, "end_pos": 197 }, { "start_pos": 241, "end_pos": 243 }, { "start_pos": 264, "end_pos": 266 }, { "start_pos": 370, "end_pos": 372 }, { "start_pos": 391, "end_pos": 393 }, { "start_pos": 435, "end_pos": 437 }, { "start_pos": 465, "end_pos": 467 }, { "start_pos": 97, "end_pos": 99 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }