{ "uniprot_canonical_ac": "A0A0R4ILA8-1", "uniprot_ac": "A0A0R4ILA8", "uniprot_id": "A0A0R4ILA8_DANRE", "mass": { "chemical_mass": 47883.0, "monoisotopic_mass": 47883.0 }, "refseq": { "ac": "XP_005169019", "name": "26S proteasome regulatory subunit 6A isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005169019" }, "gene_names": [ { "name": "psmc3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8", "id": "A0A0R4ILA8" }, { "name": "psmc3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005169019", "id": "XP_005169019" }, { "name": "wu:fb39a02; zgc:86713", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005169019", "id": "XP_005169019" }, { "name": "wu:fb39a02", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8", "id": "A0A0R4ILA8" }, { "name": "zgc:86713", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8", "id": "A0A0R4ILA8" } ], "protein_names": [ { "name": "26S proteasome regulatory subunit 6A isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005169019", "id": "XP_005169019" }, { "name": "26S proteasome regulatory subunit 6A isoform X1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8/entry#names_and_taxonomy", "id": "A0A0R4ILA8" }, { "name": "Proteasome 26S subunit, ATPase 3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8/entry#names_and_taxonomy", "id": "A0A0R4ILA8" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_049306965.1-RS_2025_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/11/2025 ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_133182) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_005169019", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005169019" } ] } ], "disease": [ { "disease_id": "DOID:10003", "recommended_name": { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "sensorineural hearing loss", "description": "An inner ear disease that is characterized by hearing loss resulting from damage to the cochlea, auditory nerve and/or brainstem." }, "synonyms": [ { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "High Frequency Hearing Loss", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "High frequency deafness", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "Perceptive deafness", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "Perceptive hearing loss", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "Perceptive hearing loss or deafness", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "Sensorineural Deafness", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "Sensory hearing loss", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "central hearing loss", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "high-frequency hearing loss", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "10003", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10003" } ] }, { "disease_id": "DOID:83", "recommended_name": { "id": "DOID:83", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:83", "name": "cataract", "description": "A lens disease characterized by clouding of the lens inside the eye which leads to a decrease in vision." }, "synonyms": [ { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract 1 multiple types", "description": "Any cataract (disease) in which the cause of the disease is a mutation in the GJA8 gene." }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "CTRCT1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "Duffy linked cataract", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "GJA8 cataract (disease)", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract (disease) caused by mutation in GJA8", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract 1, multiple types, with or without microcornea", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "CAE1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "CZP1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "zonular pulverulent cataract 1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract 1, multiple types", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract, Duffy-linked", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract, zonular pulverulent, 1", "description": "" }, { "id": "MONDO:0011060", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011060", "name": "early-onset non-syndromic cataract", "description": "Early-onset non-syndromic cataract is a rare, genetic, non-syndromic developmental defect of the eye, with high clinical and genetic heterogeneity, most frequently characterized by bilateral, symmetrical, non-progressive cataracts which present at birth or in early-childhood. Additional ocular manifestations (e.g. anterior segment dysgenesis, colobomas, nystagmus, microcornea, microphthalmia, myopia) may be associated, however other organs/systems are usually not affected." }, { "id": "MONDO:0011060", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011060", "name": "cataract, age-related nuclear", "description": "" }, { "id": "MONDO:0011060", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011060", "name": "nuclear sclerosis of the lens", "description": "" }, { "id": "MIM:116200", "resource": "MIM", "url": "https://www.omim.org/entry/116200", "name": "Cataract 1, multiple types", "description": "Cataract 1, multiple types" } ], "unlinked_id_list": [], "evidence": [ { "id": "83", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:83" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ILA8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "psmc3", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-030131-666", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-666", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000007141", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000007141", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "321947", "url": "https://www.ncbi.nlm.nih.gov/gene/321947", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003593", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003593", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003959", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003959", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003960", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003960", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012340", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012340", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032501", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032501", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041569", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041569", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050221", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050221", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:321947", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:321947", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NKISHEH", "url": "https://omabrowser.org/oma/group/NKISHEH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4ILA8", "url": "https://www.orthodb.org/?gene=A0A0R4ILA8", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A8M2BGA0", "url": "https://www.orthodb.org/?gene=A0A8M2BGA0", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "Q6IQL5", "url": "https://www.orthodb.org/?gene=Q6IQL5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23073", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23073", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00004", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00004", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16450", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF16450", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17862", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17862", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_005169019", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005169019", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4ILA8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4ILA8-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M2BGA0", "url": "https://www.uniprot.org/uniprotkb/A0A8M2BGA0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M2BGA0-1", "url": "https://www.uniprot.org/uniprotkb/A0A8M2BGA0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6IQL5-1", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-030131-666", "url": "https://zfin.org/ZDB-GENE-030131-666", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MSSLNDRSVWDEVEDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENTEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNMQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVCPDVNFEELARCTDDFNGAQCKAVCVEAGMIALRRGATELNHEDYMEGILEVQAKKKANLQYYA", "length": 427, "header": "tr|A0A0R4ILA8-1|A0A0R4ILA8_DANRE Isoform 1 of Proteasome 26S subunit, ATPase 3 OS=Danio rerio OX=7955 GN=psmc3 PE=1 SV=1 CANONICAL=A0A0R4ILA8-1" }, "isoforms": [ { "isoform_ac": "A0A0R4ILA8-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8/entry#A0A0R4ILA8-1", "sequence": { "sequence": "MSSLNDRSVWDEVEDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENTEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNMQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVCPDVNFEELARCTDDFNGAQCKAVCVEAGMIALRRGATELNHEDYMEGILEVQAKKKANLQYYA", "length": 427, "header": "tr|A0A0R4ILA8-1|A0A0R4ILA8_DANRE Isoform 1 of Proteasome 26S subunit, ATPase 3 OS=Danio rerio OX=7955 GN=psmc3 PE=1 SV=1 CANONICAL=A0A0R4ILA8-1" }, "locus": {} }, { "isoform_ac": "A0A8M2BGA0-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8/entry#A0A8M2BGA0-1", "sequence": { "sequence": "MSSLNDRSVWDEDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENTEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNMQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVCPDVNFEELARCTDDFNGAQCKAVCVEAGMIALRRGATELNHEDYMEGILEVQAKKKANLQYYA", "length": 425, "header": "tr|A0A8M2BGA0-1|A0A8M2BGA0_DANRE Computationally mapped isoform of 26S proteasome regulatory subunit 6A isoform X2 OS=Danio rerio OX=7955 GN=psmc3 PE=1 SV=1 CANONICAL=A0A0R4ILA8-1" }, "locus": {} }, { "isoform_ac": "Q6IQL5-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8/entry#Q6IQL5-1", "sequence": { "sequence": "MSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENTEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNMQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVCLDVNFEELARCTDDFNGAQCKAVCVEAGMIALRRGATELNHEDYMEGILEVQAKKKANLQYYA", "length": 404, "header": "tr|Q6IQL5-1|Q6IQL5_DANRE Computationally mapped isoform of Proteasome (Prosome, macropain) 26S subunit, ATPase, 3 OS=Danio rerio OX=7955 GN=psmc3 PE=1 SV=1 CANONICAL=A0A0R4ILA8-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "A comparative map of the zebrafish genome.", "journal": "Genome Res.", "date": "2000", "authors": "Woods I G, Kelly P D, Chu F, Ngo-Hazelett P, Yan Y L, Huang H, Postlethwait J H, Talbot W S", "evidence": [ { "database": "UniProtKB", "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5" } ], "reference": [ { "type": "PubMed", "id": "11116086", "url": "https://glygen.org/publication/PubMed/11116086" } ] }, { "title": "Comparative analysis of the PDCD2-TBP-PSMB1 region in vertebrates.", "journal": "Gene", "date": "2004", "authors": "Trachtulec Zdenek, Vlcek Cestmir, Mihola Ondrej, Forejt Jiri", "evidence": [ { "database": "UniProtKB", "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5" } ], "reference": [ { "type": "PubMed", "id": "15194198", "url": "https://glygen.org/publication/PubMed/15194198" } ] }, { "title": "The zebrafish gene map defines ancestral vertebrate chromosomes.", "journal": "Genome Res.", "date": "2005", "authors": "Woods Ian G, Wilson Catherine, Friedlander Brian, Chang Patricia, Reyes Daengnoy K, Nix Rebecca, Kelly Peter D, Chu Felicia, Postlethwait John H, Talbot William S", "evidence": [ { "database": "UniProtKB", "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5" } ], "reference": [ { "type": "PubMed", "id": "16109975", "url": "https://glygen.org/publication/PubMed/16109975" } ] }, { "title": "Mercury-induced hepatotoxicity in zebrafish: in vivo mechanistic insights from transcriptome analysis, phenotype anchoring and targeted gene expression validation.", "journal": "BMC Genomics", "date": "2010", "authors": "Ung Choong Yong, Lam Siew Hong, Hlaing Mya Myintzu, Winata Cecilia Lanny, Korzh Svetlana, Mathavan Sinnakaruppan, Gong Zhiyuan", "evidence": [ { "database": "UniProtKB", "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5" } ], "reference": [ { "type": "PubMed", "id": "20353558", "url": "https://glygen.org/publication/PubMed/20353558" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ILA8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "RFX transcription factors are essential for hearing in mice.", "journal": "Nat. Commun.", "date": "2015", "authors": "Elkon Ran, Milon Beatrice, Morrison Laura, Shah Manan, Vijayakumar Sarath, Racherla Manoj, Leitch Carmen C, Silipino Lorna, Hadi Shadan, Weiss-Gayet Mich\u00e8le, Barras Emmanu\u00e8le, Schmid Christoph D, Ait-Lounis Aouatef, Barnes Ashley, Song Yang, Eisenman David J, Eliyahu Efrat, Frolenkov Gregory I, Strome Scott E, Durand B\u00e9n\u00e9dicte, Zaghloul Norann A, Jones Sherri M, Reith Walter, Hertzano Ronna", "evidence": [ { "database": "UniProtKB", "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5" } ], "reference": [ { "type": "PubMed", "id": "26469318", "url": "https://glygen.org/publication/PubMed/26469318" } ] }, { "title": "Tissue Extract Fractions from Starfish Undergoing Regeneration Promote Wound Healing and Lower Jaw Blastema Regeneration of Zebrafish.", "journal": "Sci. Rep.", "date": "2016", "authors": "Dai Yancen, Prithiviraj Nagarajan, Gan Jianhong, Zhang Xin A, Yan Jizhou", "evidence": [ { "database": "UniProtKB", "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5" } ], "reference": [ { "type": "PubMed", "id": "27974833", "url": "https://glygen.org/publication/PubMed/27974833" } ] }, { "title": "Evolution of complexity in the zebrafish synapse proteome.", "journal": "Nat. Commun.", "date": "2017", "authors": "Bayes A, Collins MO, Reig-Viader R, Gou G, Goulding D, Izquierdo A, Choudhary JS, Emes RD, Grant SG", "evidence": [ { "database": "UniProtKB", "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5" } ], "reference": [ { "type": "PubMed", "id": "28252024", "url": "https://glygen.org/publication/PubMed/28252024" } ] }, { "title": "Characterization of the Apelin/Elabela Receptors (APLNR) in Chickens, Turtles, and Zebrafish: Identification of a Novel Apelin-Specific Receptor in Teleosts.", "journal": "Front. Endocrinol.", "date": "2018", "authors": "Zhang Jiannan, Zhou Yawei, Wu Chenlei, Wan Yiping, Fang Chao, Li Jing, Fang Wenqian, Yi Ran, Zhu Guoqiang, Li Juan, Wang Yajun", "evidence": [ { "database": "UniProtKB", "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5" } ], "reference": [ { "type": "PubMed", "id": "30631305", "url": "https://glygen.org/publication/PubMed/30631305" } ] }, { "title": "Proteasome subunit PSMC3 variants cause neurosensory syndrome combining deafness and cataract due to proteotoxic stress.", "journal": "EMBO Mol. Med.", "date": "2020", "authors": "Kroll-Hermi A, Ebstein F, Stoetzel C, Geoffroy V, Schaefer E, Scheidecker S, Bar S, Takamiya M, Kawakami K, Zieba BA, Studer F, Pelletier V, Eyermann C, Speeg-Schatz C, Laugel V, Lipsker D, Sandron F, McGinn S, Boland A, Deleuze JF, Kuhn L, Chicher J, Hammann P, Friant S, Etard C, Kruger E, Muller J, Strahle U, Dollfus H", "evidence": [ { "database": "UniProtKB", "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5" } ], "reference": [ { "type": "PubMed", "id": "32500975", "url": "https://glygen.org/publication/PubMed/32500975" } ] }, { "title": "Screening Study on the Anti-Angiogenic Effects of Traditional Chinese Medicine - Part II: Wild Chrysanthemum.", "journal": "J. Cancer", "date": "2021", "authors": "Tu Xiang, Wang He Bin, Huang Qun, Cai Yi, Deng Yuan Ping, Yong Zhe, Hu Quan, Feng Jian, Jordan James B, Zhong Sen", "evidence": [ { "database": "UniProtKB", "id": "Q6IQL5", "url": "https://www.uniprot.org/uniprotkb/Q6IQL5" } ], "reference": [ { "type": "PubMed", "id": "33391408", "url": "https://glygen.org/publication/PubMed/33391408" } ] } ], "pathway": [ { "id": "dre:321947", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:321947", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O88685-1", "protein_name": "26S proteasome regulatory subunit 6A", "gene_name": "Psmc3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQEMNLLPTPESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA", "length": 442 }, "evidence": [ { "id": "HGNC:9549", "url": "https://alliancegenome.org/gene/HGNC:9549#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-030131-666", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-666#orthology", "database": "AGR" }, { "id": "MGI:1098754", "url": "https://alliancegenome.org/gene/MGI:1098754#orthology", "database": "AGR" }, { "id": "A0A0R4ILA8", "url": "https://omabrowser.org/oma/group/A0A0R4ILA8/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P17980-1", "protein_name": "26S proteasome regulatory subunit 6A", "gene_name": "PSMC3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA", "length": 439 }, "evidence": [ { "id": "HGNC:9549", "url": "https://alliancegenome.org/gene/HGNC:9549#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-030131-666", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-666#orthology", "database": "AGR" }, { "id": "MGI:1098754", "url": "https://alliancegenome.org/gene/MGI:1098754#orthology", "database": "AGR" }, { "id": "A0A0R4ILA8", "url": "https://omabrowser.org/oma/group/A0A0R4ILA8/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P33297-1", "protein_name": "26S proteasome regulatory subunit 6A", "gene_name": "RPT5", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA", "length": 434 }, "evidence": [ { "id": "HGNC:9549", "url": "https://alliancegenome.org/gene/HGNC:9549#orthology", "database": "AGR" }, { "id": "MGI:1098754", "url": "https://alliancegenome.org/gene/MGI:1098754#orthology", "database": "AGR" }, { "id": "A0A0R4ILA8", "url": "https://omabrowser.org/oma/group/A0A0R4ILA8/", "database": "OMA" } ], "glygen_name": "Yeast", "common_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q54PN7-1", "protein_name": "26S proteasome regulatory subunit 6A homolog", "gene_name": "psmC3", "tax_id": 44689, "organism": "Dictyostelium discoideum", "sequence": { "sequence": "MSNKRTTTKDESLPQAEKEAVIPDEIFQMTADEVNRKAKLLENETKVLRSEHISKHLEMDSIQKRIKENNDKLQVNTQLPHLVANVVEIIDMVLDGETQPSKCVVVKASTRQTIFLAYPGIVDVDKLRPGDLVGINKDSYIILDTLPPEYDSRVKAMEIDEKPTEEYSDIGGLDKQIQELVEAVVLPMTHKERFESIGIKPPKGVLMYGPPGTGKTLLARACAAQTNSTYLKLAGPQLVQMFIGDGAKLVRDAFALAKEKGPTIIFIDELDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDANIKVIAATNRIDILDPALLRSGRLDRKIEFPLPNEEARAHILQIHSRKMNVSADVNFDELARSSEDFNGAQLKAVCVEAGMIALRRGGTELIHNDFVEGCVEVMAKKKKTLEYYA", "length": 421 }, "evidence": [ { "id": "A0A0R4ILA8", "url": "https://omabrowser.org/oma/group/A0A0R4ILA8/", "database": "OMA" } ], "glygen_name": "Cellular slime mold", "common_name": "Social amoeba" }, { "uniprot_canonical_ac": "Q63569-1", "protein_name": "26S proteasome regulatory subunit 6A", "gene_name": "Psmc3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNLLPTPESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA", "length": 439 }, "evidence": [ { "id": "HGNC:9549", "url": "https://alliancegenome.org/gene/HGNC:9549#orthology", "database": "AGR" }, { "id": "MGI:1098754", "url": "https://alliancegenome.org/gene/MGI:1098754#orthology", "database": "AGR" }, { "id": "A0A0R4ILA8", "url": "https://omabrowser.org/oma/group/A0A0R4ILA8/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9SEI2-1", "protein_name": "26S proteasome regulatory subunit 6A homolog A", "gene_name": "RPT5A", "tax_id": 3702, "organism": "Arabidopsis thaliana", "sequence": { "sequence": "MATPMVEDTSSFEEDQLASMSTEDITRATRLLDNEIRILKEDAQRTNLECDSYKEKIKENQEKIKLNKQLPYLVGNIVEILEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPVVGLVDPDSLKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFEKLGVRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKAPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRADILDPALMRSGRLDRKIEFPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA", "length": 424 }, "evidence": [ { "id": "A0A0R4ILA8", "url": "https://omabrowser.org/oma/group/A0A0R4ILA8/", "database": "OMA" } ], "glygen_name": "Arabidopsis", "common_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9V3V6-1", "protein_name": "5.6.1.5", "gene_name": "Rpt5", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MAQTLEDKSIWEDGEESLGEEVMRMSTDEIVSRTRLMDNEIKIMKSEVIRITHEIQAQNEKIKDNTEKIKVNKTLPYLVSNVIELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTHEDFMDAIMEVQAKKKANLNYYA", "length": 428 }, "evidence": [ { "id": "HGNC:9549", "url": "https://alliancegenome.org/gene/HGNC:9549#orthology", "database": "AGR" }, { "id": "MGI:1098754", "url": "https://alliancegenome.org/gene/MGI:1098754#orthology", "database": "AGR" }, { "id": "A0A0R4ILA8", "url": "https://omabrowser.org/oma/group/A0A0R4ILA8/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "proteasome regulatory particle, base subcomplex", "id": "GO:0008540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008540", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ILA8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ILA8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8" } ], "pmid": "" }, { "name": "ATP hydrolysis activity", "id": "GO:0016887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ILA8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8" } ], "pmid": "" }, { "name": "proteasome-activating activity", "id": "GO:0036402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036402", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ILA8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ILA8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8" } ], "pmid": "" }, { "name": "lens development in camera-type eye", "id": "GO:0002088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002088", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ILA8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8" } ], "pmid": "" }, { "name": "semicircular canal fusion", "id": "GO:0060879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060879", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ILA8", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ILA8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 71, "end_pos": 73, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 71, "end_pos": 73 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }