{ "uniprot_canonical_ac": "A0A0R4IL29-1", "uniprot_ac": "A0A0R4IL29", "uniprot_id": "A0A0R4IL29_DANRE", "mass": { "chemical_mass": 48288.0, "monoisotopic_mass": 48288.0 }, "refseq": { "ac": "NP_958873", "name": "calreticulin 3b precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958873" }, "gene_names": [ { "name": "calr3b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29", "id": "A0A0R4IL29" }, { "name": "calr3; calrl; id:ibd1087; wu:fc59g10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958873", "id": "NP_958873" }, { "name": "calr3b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958873", "id": "NP_958873" }, { "name": "calr3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29", "id": "A0A0R4IL29" }, { "name": "calrl", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29", "id": "A0A0R4IL29" }, { "name": "id:ibd1087", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29", "id": "A0A0R4IL29" }, { "name": "wu:fc59g10", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29", "id": "A0A0R4IL29" } ], "protein_names": [ { "name": "Calreticulin", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29/entry#names_and_taxonomy", "id": "A0A0R4IL29" }, { "name": "calreticulin 3b precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958873", "id": "NP_958873" }, { "name": "calreticulin like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958873", "id": "NP_958873" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: GFIL01002926.1, GDQQ01000357.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA3505376, SAMEA3505381 [ECO:0006172] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JBMGRA010000002.1, EH579061.1 and EH602296.1. On Jun 19, 2015 this sequence version replaced NP_958873.2. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.", "evidence": [ { "database": "RefSeq", "id": "NP_958873", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958873" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "calr3b", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-030131-9907", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-9907", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000102808", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000102808", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "321315", "url": "https://www.ncbi.nlm.nih.gov/gene/321315", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001580", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001580", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009033", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009033", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009169", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009169", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013320", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013320", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018124", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018124", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:321315", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:321315", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ERWVKSD", "url": "https://omabrowser.org/oma/group/ERWVKSD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IL29", "url": "https://www.orthodb.org/?gene=A0A0R4IL29", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11073", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11073", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11073:SF42", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11073:SF42", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00262", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00262", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_958873", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958873", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IL29-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-030131-9907", "url": "https://zfin.org/ZDB-GENE-030131-9907", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MQISLLQLISAALLALAANAEVYLNEQFLDGDAWRSRWVNSEHKSDYGQFKLTAGNFYGDAEKDKGLQTSQDARFYATSVRFEPFSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPADLNQADMHGDSQYYIMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIKCKDDELTHLYTLILNPDQTYEVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPEDWDDRAKIDDETDTKPEDWDKPENIPDPDAKKPEDWDEDMDGEWEPAMIPNPEYKGEWKPKQIDNPNYKGAWVHPEIDNPEHVPDDQIYKFDNIGVLGLDLWQVKSGTIFDNFFISDDVKEAEEFGNETWGATKGPEKKMKEEQEEKKRKEEEEKNKEQNTEAADEEEEDEGEEEEEEDETEEPQEDEGDEDVLQKDEL", "length": 417, "header": "tr|A0A0R4IL29-1|A0A0R4IL29_DANRE Isoform 1 of Calreticulin OS=Danio rerio OX=7955 GN=calr3b PE=1 SV=1 CANONICAL=A0A0R4IL29-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IL29-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29/entry#A0A0R4IL29-1", "sequence": { "sequence": "MQISLLQLISAALLALAANAEVYLNEQFLDGDAWRSRWVNSEHKSDYGQFKLTAGNFYGDAEKDKGLQTSQDARFYATSVRFEPFSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPADLNQADMHGDSQYYIMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIKCKDDELTHLYTLILNPDQTYEVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPEDWDDRAKIDDETDTKPEDWDKPENIPDPDAKKPEDWDEDMDGEWEPAMIPNPEYKGEWKPKQIDNPNYKGAWVHPEIDNPEHVPDDQIYKFDNIGVLGLDLWQVKSGTIFDNFFISDDVKEAEEFGNETWGATKGPEKKMKEEQEEKKRKEEEEKNKEQNTEAADEEEEDEGEEEEEEDETEEPQEDEGDEDVLQKDEL", "length": 417, "header": "tr|A0A0R4IL29-1|A0A0R4IL29_DANRE Isoform 1 of Calreticulin OS=Danio rerio OX=7955 GN=calr3b PE=1 SV=1 CANONICAL=A0A0R4IL29-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Analysis of protein expression in developmental toxicity induced by MeHg in zebrafish.", "journal": "Analyst", "date": "2012", "authors": "Cuello Susana, Xim\u00e9nez-Emb\u00fan Pilar, Ruppen Isabel, Schonthaler Helia B, Ashman Keith, Madrid Yolanda, Luque-Garcia Jose L, C\u00e1mara Carmen", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "reference": [ { "type": "PubMed", "id": "23014190", "url": "https://glygen.org/publication/PubMed/23014190" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "A novel chemical screening strategy in zebrafish identifies common pathways in embryogenesis and rhabdomyosarcoma development.", "journal": "Development", "date": "2013", "authors": "Le Xiuning, Pugach Emily K, Hettmer Simone, Storer Narie Y, Liu Jianing, Wills Airon A, DiBiase Antony, Chen Eleanor Y, Ignatius Myron S, Poss Kenneth D, Wagers Amy J, Langenau David M, Zon Leonard I", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "reference": [ { "type": "PubMed", "id": "23615277", "url": "https://glygen.org/publication/PubMed/23615277" } ] }, { "title": "Proteome mapping of adult zebrafish marrow neutrophils reveals partial cross species conservation to human peripheral neutrophils.", "journal": "PLoS ONE", "date": "2013", "authors": "Singh Sachin Kumar, Sethi Sachin, Aravamudhan Sriram, Kr\u00fcger Marcus, Grabher Clemens", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "reference": [ { "type": "PubMed", "id": "24019943", "url": "https://glygen.org/publication/PubMed/24019943" } ] }, { "title": "Matrix metalloproteinase-9 plays a role in protecting zebrafish from lethal infection with Listeria monocytogenes by enhancing macrophage migration.", "journal": "Fish Shellfish Immunol.", "date": "2016", "authors": "Shan Ying, Zhang Yikai, Zhuo Xunhui, Li Xiaoliang, Peng Jinrong, Fang Weihuan", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "reference": [ { "type": "PubMed", "id": "27068748", "url": "https://glygen.org/publication/PubMed/27068748" } ] }, { "title": "Gene evolution and gene expression after whole genome duplication in fish: the PhyloFish database.", "journal": "BMC Genomics", "date": "2016", "authors": "Pasquier Jeremy, Cabau C\u00e9dric, Nguyen Thaovi, Jouanno Elodie, Severac Dany, Braasch Ingo, Journot Laurent, Pontarotti Pierre, Klopp Christophe, Postlethwait John H, Guiguen Yann, Bobe Julien", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "reference": [ { "type": "PubMed", "id": "27189481", "url": "https://glygen.org/publication/PubMed/27189481" } ] }, { "title": "Expression of CALR mutants causes mpl-dependent thrombocytosis in zebrafish.", "journal": "Blood Cancer J.", "date": "2016", "authors": "Lim K-H, Chang Y-C, Chiang Y-H, Lin H-C, Chang C-Y, Lin C-S, Huang L, Wang W-T, Gon-Shen Chen C, Chou W-C, Kuo Y-Y", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "reference": [ { "type": "PubMed", "id": "27716741", "url": "https://glygen.org/publication/PubMed/27716741" } ] }, { "title": "Whole genome duplications have provided teleosts with many roads to peptide loaded MHC class I molecules.", "journal": "BMC Evol. Biol.", "date": "2018", "authors": "Grimholt Unni", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "reference": [ { "type": "PubMed", "id": "29471808", "url": "https://glygen.org/publication/PubMed/29471808" } ] } ], "pathway": [ { "id": "dre:321315", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:321315", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O04153-1", "protein_name": "Calreticulin-3", "gene_name": "CRT3", "tax_id": 3702, "organism": "Arabidopsis thaliana", "sequence": { "sequence": "MGLPQNKLSFFCFFFLVSVLTLAPLAFSEIFLEEHFEGGWKSRWVLSDWKRNEGKAGTFKHTAGKWPGDPDNKGIQTYNDAKHYAISAKIPEFSNKNRTLVVQYSVKIEQDIECGGAYIKLLSGYVNQKQFGGDTPYSLMFGPDICGTQTKKLHVIVSYQGQNYPIKKDLQCETDKLNHFYTFILRPDASYSVLVDNKEREFGSMYTDWDILPPRKIKVKNAKKPEDWDDREYIDDPNDVKPEGFDSIPREIPDRKAKEPEDWDEEENGLWEPPKIPNSAYKGPWKAKRIKNPNYKGKWKNPWIDNPEFEDDPDLYVLKSIKYAGIEVWQVKAGSIFDNILICDDPAYARSIVDDYFAQHRESEKELFAEAEKERKAREDEEARIAREEGERRRKERDHRYGDRRRRYKRPNPRDYMDDYHDEL", "length": 424 }, "evidence": [ { "id": "A0A0R4IL29", "url": "https://omabrowser.org/oma/group/A0A0R4IL29/", "database": "OMA" } ], "glygen_name": "Arabidopsis", "common_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P29413-1", "protein_name": "Calreticulin", "gene_name": "Calr", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MMWCKTVIVLLATVGFISAEVYLKENFDNENWEDTWIYSKHPGKEFGKFVLTPGTFYNDAEADKGIQTSQDARFYAASRKFDGFSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSYKGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDWDFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKPEDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEVKNTQAGEKKMKEAQDEVQRKKDEEEAKKASDKDDEDEDDDDEEKDDESKQDKDQSEHDEL", "length": 406 }, "evidence": [ { "id": "MGI:1920566", "url": "https://alliancegenome.org/gene/MGI:1920566#orthology", "database": "AGR" }, { "id": "HGNC:20407", "url": "https://alliancegenome.org/gene/HGNC:20407#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q6AYG8-1", "protein_name": "Calreticulin", "gene_name": "Calr3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVRARVSLWAICVLRVALATVYFQEEFLDGERWRNRWVQSTNDSQFGHFRVSSGKFYGHKEKDKGLQTTQNSRFYAISASFKPFSNKGKTLVIQYTVKHEQKIDCGGGYIKVFPSDLDQKNLNGKSQYYIMFGPDICGFDIKKVHVILYFKNQYHENKKSIRCKVDGFTHLYTLILRPDLSYEVKVDGQSIESGSIEYDWNLTSLKKMEKTSLESRDWDEVEGNKAQDWEKHFLDAGPSKPSDWNSELDGDWLQKPPYEDGLKAEGIDKDVWLHQKMRPAGYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYAEKFGKATWGETKGPEKEMDAIQAKEEVKKAREEDEDLLMGKFHRHNHFSRFHRQGEL", "length": 379 }, "evidence": [ { "id": "MGI:1920566", "url": "https://alliancegenome.org/gene/MGI:1920566#orthology", "database": "AGR" }, { "id": "HGNC:20407", "url": "https://alliancegenome.org/gene/HGNC:20407#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6PE26-1", "protein_name": "Calreticulin", "gene_name": "calr3a", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MRITAAVCFISALAFIAHADVYFKEQFLDGDGWKSRWVESKHKSDYGQWKLTSGKFYGDAELDKGLQTSQDARFYALSSRFDSFSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPAEMDQTEMHGESQYYIMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIKCKDDELTHLYTLILRPDQTYEVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPDDWDDRAKIDDPEDTKPEDWDKPENIPDPDAKKPDDWDEDMDGEWEPAMIPNPEYKGEWKPKQIDNPSYKGTWVHPEIDNPEYAADDAIYKFDSIGVLGLDLWQVKSGTIFDNFLITDDVEEAEKFGTDTWGATKGPEKKMKDQQEEEERKKREEEEKSKKDDNEEDEEDEDEDEPEEDDHTEEPPEEEEEGEDDALPKDEL", "length": 418 }, "evidence": [ { "id": "MGI:1920566", "url": "https://alliancegenome.org/gene/MGI:1920566#orthology", "database": "AGR" }, { "id": "HGNC:20407", "url": "https://alliancegenome.org/gene/HGNC:20407#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q96L12-1", "protein_name": "Calreticulin-3", "gene_name": "CALR3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARALVQLWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL", "length": 384 }, "evidence": [ { "id": "MGI:1920566", "url": "https://alliancegenome.org/gene/MGI:1920566#orthology", "database": "AGR" }, { "id": "HGNC:20407", "url": "https://alliancegenome.org/gene/HGNC:20407#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-030131-9907", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-9907#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D9Q6-1", "protein_name": "Calreticulin-3", "gene_name": "Calr3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVSARALLWAICVLRVALATVYFQEEFLDGERWRNRWVQSTNDSQFGHFRVSSGKFYGHKEKDKGLQTTQNSRFYAISASFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPSDLDQKKMNGKSQYYIMFGPDICGFDIKKVHVILYFKNQYHENKKPIRCKVDGFTHLYTLILRPDLSYEVKVDGQSIESGSIEYDWNLTSLRKTEKTSLDSRDWDQVEGSKVQDWEKHFLDAGASKPSDWNSELDGDWLQKPPYEDGLKAEGIDKDVWLHQKMRPAGYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYAEKFGKATWGETKGPEKEMDAIQAKEEVKKAREEDEEDLLMGKFHRHNHFSRFHRQGEL", "length": 380 }, "evidence": [ { "id": "MGI:1920566", "url": "https://alliancegenome.org/gene/MGI:1920566#orthology", "database": "AGR" }, { "id": "HGNC:20407", "url": "https://alliancegenome.org/gene/HGNC:20407#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-030131-9907", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-9907#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "unfolded protein binding", "id": "GO:0051082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051082", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "protein folding", "id": "GO:0006457", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006457", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "pmid": "" }, { "name": "ERAD pathway", "id": "GO:0036503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036503", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IL29", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IL29" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 345, "end_pos": 347, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 345, "end_pos": 347 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }