{ "uniprot_canonical_ac": "A0A0R4II16-1", "uniprot_ac": "A0A0R4II16", "uniprot_id": "A0A0R4II16_DANRE", "mass": { "chemical_mass": 29747.0, "monoisotopic_mass": 29747.0 }, "refseq": { "ac": "NP_001002547", "name": "proteasome inhibitor PI31 subunit", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002547" }, "gene_names": [ { "name": "psmf1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16", "id": "A0A0R4II16" }, { "name": "psmf1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002547", "id": "NP_001002547" }, { "name": "zgc:92785", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002547", "id": "NP_001002547" }, { "name": "zgc:92785", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16", "id": "A0A0R4II16" } ], "protein_names": [ { "name": "Proteasome inhibitor PI31 subunit", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16/entry#names_and_taxonomy", "id": "A0A0R4II16" }, { "name": "proteasome (prosome, macropain) inhibitor subunit 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002547", "id": "NP_001002547" }, { "name": "proteasome inhibitor PI31 subunit", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002547", "id": "NP_001002547" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: GFIL01031653.1, EH473760.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA3505377, SAMEA3505378 [ECO:0006172] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JBMGRA010000006.1, EH484771.1 and CD604800.1. On Jul 20, 2010 this sequence version replaced NP_001002547.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.", "evidence": [ { "database": "RefSeq", "id": "NP_001002547", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002547" } ] }, { "annotation": "Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28.", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16#function" }, { "database": "UniProtKB", "id": "ARBA00024805", "url": "https://www.uniprot.org/uniprotkb/ARBA00024805#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "psmf1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-040718-282", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040718-282", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000022652", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000022652", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "436820", "url": "https://www.ncbi.nlm.nih.gov/gene/436820", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013886", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013886", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021625", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021625", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045128", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045128", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:436820", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:436820", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PFGFPDI", "url": "https://omabrowser.org/oma/group/PFGFPDI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4II16", "url": "https://www.orthodb.org/?gene=A0A0R4II16", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13266", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13266", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13266:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13266:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08577", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08577", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF11566", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF11566", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001002547", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002547", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4II16-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-040718-282", "url": "https://zfin.org/ZDB-GENE-040718-282", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MAGLELLFNCVSNSLTCSQDALICFVHWEIVKSGYKCMGIGDEPKDGEKKTELLPSGWNESKELYALRYRSNDDKSNLLLKAFTVDSSLIFNLMDSTTEKVTDLTVNLSEYVDEANLHTFESVFKNTDELTAKLKSSLLPSKKEERQGKTEKKTERERASNLRDPDSDPLLIPTRGPPARHPANWPDPMAPFAAGGADLDPFGGRAGGMIVDPLRAGFPRSGFDPSSGIPGVLPPGAVPPGARFDPFGPVGRHRPGPDPDHMPPPGYDDMFM", "length": 272, "header": "tr|A0A0R4II16-1|A0A0R4II16_DANRE Isoform 1 of Proteasome inhibitor PI31 subunit OS=Danio rerio OX=7955 GN=psmf1 PE=1 SV=1 CANONICAL=A0A0R4II16-1" }, "isoforms": [ { "isoform_ac": "A0A0R4II16-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16/entry#A0A0R4II16-1", "sequence": { "sequence": "MAGLELLFNCVSNSLTCSQDALICFVHWEIVKSGYKCMGIGDEPKDGEKKTELLPSGWNESKELYALRYRSNDDKSNLLLKAFTVDSSLIFNLMDSTTEKVTDLTVNLSEYVDEANLHTFESVFKNTDELTAKLKSSLLPSKKEERQGKTEKKTERERASNLRDPDSDPLLIPTRGPPARHPANWPDPMAPFAAGGADLDPFGGRAGGMIVDPLRAGFPRSGFDPSSGIPGVLPPGAVPPGARFDPFGPVGRHRPGPDPDHMPPPGYDDMFM", "length": 272, "header": "tr|A0A0R4II16-1|A0A0R4II16_DANRE Isoform 1 of Proteasome inhibitor PI31 subunit OS=Danio rerio OX=7955 GN=psmf1 PE=1 SV=1 CANONICAL=A0A0R4II16-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Hematopoietic gene expression profile in zebrafish kidney marrow.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Song Huai-Dong, Sun Xiao-Jian, Deng Min, Zhang Guo-Wei, Zhou Yi, Wu Xin-Yan, Sheng Yan, Chen Yi, Ruan Zheng, Jiang Chun-Lei, Fan Hui-Yong, Zon Leonard I, Kanki John P, Liu Ting Xi, Look A Thomas, Chen Zhu", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "reference": [ { "type": "PubMed", "id": "15520368", "url": "https://glygen.org/publication/PubMed/15520368" } ] }, { "title": "RNA-seq liver transcriptome analysis reveals an activated MHC-I pathway and an inhibited MHC-II pathway at the early stage of vaccine immunization in zebrafish.", "journal": "BMC Genomics", "date": "2012", "authors": "Yang Dahai, Liu Qin, Yang Minjun, Wu Haizhen, Wang Qiyao, Xiao Jingfan, Zhang Yuanxing", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "reference": [ { "type": "PubMed", "id": "22805612", "url": "https://glygen.org/publication/PubMed/22805612" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Chromosomal deletions and inversions mediated by TALENs and CRISPR/Cas in zebrafish.", "journal": "Nucleic Acids Res.", "date": "2013", "authors": "Xiao An, Wang Zhanxiang, Hu Yingying, Wu Yingdan, Luo Zhou, Yang Zhipeng, Zu Yao, Li Wenyuan, Huang Peng, Tong Xiangjun, Zhu Zuoyan, Lin Shuo, Zhang Bo", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "reference": [ { "type": "PubMed", "id": "23748566", "url": "https://glygen.org/publication/PubMed/23748566" } ] }, { "title": "RFX transcription factors are essential for hearing in mice.", "journal": "Nat. Commun.", "date": "2015", "authors": "Elkon Ran, Milon Beatrice, Morrison Laura, Shah Manan, Vijayakumar Sarath, Racherla Manoj, Leitch Carmen C, Silipino Lorna, Hadi Shadan, Weiss-Gayet Mich\u00e8le, Barras Emmanu\u00e8le, Schmid Christoph D, Ait-Lounis Aouatef, Barnes Ashley, Song Yang, Eisenman David J, Eliyahu Efrat, Frolenkov Gregory I, Strome Scott E, Durand B\u00e9n\u00e9dicte, Zaghloul Norann A, Jones Sherri M, Reith Walter, Hertzano Ronna", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "reference": [ { "type": "PubMed", "id": "26469318", "url": "https://glygen.org/publication/PubMed/26469318" } ] } ], "pathway": [ { "id": "dre:436820", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:436820", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8W4FHK5-1", "protein_name": "Proteasome inhibitor PI31 subunit", "gene_name": "PSMF1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MVSRELGISTLLSLGNPELGAAASCHVLSIILGPRLWHGLCAAQAAGAQPERHLPSALLLSHSQASQGQLRPLLMARPGARMAGLEVLFASAAPTITCAQDALVCFLHWEVVTHGYYGLGAGDQPGPSDKKSELLPAEWNSNKDLYVLRYESKDGSRKLLVKAVTVENSMIINVLECGSQQVSDLTLNLNDYIDSEHLVDFHRAYKNSEELRSRIVSGIITPIHEHWDKASVSPHREFPPATAREVDPLRIHPHHPHTTHASPAIPLLEPSRVGVAVVLVHLTTFTSSPTAACHTCLPIIPSCLRCRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL", "length": 374 }, "evidence": [ { "id": "A0A0R4II16", "url": "https://omabrowser.org/oma/group/A0A0R4II16/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "G3H6Y0-1", "protein_name": "Proteasome inhibitor PI31 subunit", "gene_name": "Psmf1", "tax_id": 10029, "organism": "Cricetulus griseus", "sequence": { "sequence": "MAGLEVLFASAAPAISCPQDALVCFLHWEVVTNGYYVLGTGDQPDSSDKKSELLPPKWSSNKELYVLRYESKDGTKKLLLKAVSVESAMIINVLEHGTQQVADLTLNLDDYIDAEDLSDFHRTYKNGEELRSRIRSGIITPIHEQWEKARVSSPHREFPPATAREVDPLRIPSHHPHPSRQPPWRDPLSPFAVGGEDLDPFGCQRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL", "length": 271 }, "evidence": [ { "id": "A0A0R4II16", "url": "https://omabrowser.org/oma/group/A0A0R4II16/", "database": "OMA" } ], "glygen_name": "Hamster", "common_name": "Chinese hamster" }, { "uniprot_canonical_ac": "Q3SX30-1", "protein_name": "Proteasome inhibitor PI31 subunit", "gene_name": "PSMF1", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MAGLEVLFASAAPAITCAQDALVCFLHWEVVTHGYYGLGAGDQPGPNDKKSELLPVEWNSNKDLYVLRYESKDGSRKLLVKAVTVENSMIINVLEHGSQQVSDLTLNLNDYIDSEHLVDFHRVYKNSEELRSRIVSGIITPIHEQWEKANLSPHREFPPATAREVDPLRIHPQHPHTSRQPTWCDPLGPFAVGGEDLDPFGCRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL", "length": 270 }, "evidence": [ { "id": "A0A0R4II16", "url": "https://omabrowser.org/oma/group/A0A0R4II16/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q54S82-1", "protein_name": "Proteasome inhibitor PI31 subunit", "gene_name": "psmF1", "tax_id": 44689, "organism": "Dictyostelium discoideum", "sequence": { "sequence": "MENFIKERLKSLIGNDNSIGIRDKYDVAVLVIALILNKHEFKLEGGEETNDKVVPTNWNSNADSYTLDLINHLAPGKTFHFKCLRMGNLLLVNAMIKDKNDKIHTLDVDTDKLVKNTEYKDVENLLLNLKEFISIFEYSIINPLVPGLVRIPTNMQEQQPQQQQQQQQQQQQERRPPNNQRDFEDDDPLRVGDPQRGSNRYRGGFNGGGDQDPDLYPPGFPVFGHNPPFYPGQTRGPGVFPGQGGQVGRDHPGFGNIHNPYGGGNNPYGTGLPGYEQRLPRGAVPPGARFDPFGPPTGGIPPSGRGRGMPDRDDFTPPGFDNDHYM", "length": 326 }, "evidence": [ { "id": "A0A0R4II16", "url": "https://omabrowser.org/oma/group/A0A0R4II16/", "database": "OMA" } ], "glygen_name": "Cellular slime mold", "common_name": "Social amoeba" }, { "uniprot_canonical_ac": "Q5XIU5-1", "protein_name": "Proteasome inhibitor PI31 subunit", "gene_name": "Psmf1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAGLEVLFASAAPAMTCPQDALVCFLHWEVVTNGYYGLGTGDQPDPNDKKSELLPAEWNSNKELYALRYESKDGARKLLLKAVSVENGMIINVLEHGTQQVADLTLNLDDYIDAEDLSDFHRTYKNSEELRSRIRSGIITPIHEQWEKVRLSSPPREFPPATAREVDPLRISSHHPHTSRQPTWRDPLSPFAVGGEDLDPFGCQRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL", "length": 271 }, "evidence": [ { "id": "MGI:1346072", "url": "https://alliancegenome.org/gene/MGI:1346072#orthology", "database": "AGR" }, { "id": "HGNC:9571", "url": "https://alliancegenome.org/gene/HGNC:9571#orthology", "database": "AGR" }, { "id": "A0A0R4II16", "url": "https://omabrowser.org/oma/group/A0A0R4II16/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q5ZJL3-1", "protein_name": "Proteasome inhibitor PI31 subunit", "gene_name": "PSMF1", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MAGLEVLYCSARAGISCPQDALVCGIHWELIQHGYRCLGAGEQPGPEERKSELLPAGWEANKEVYTLRYKSTDDARELLLKAIVVEDSMILNVMDRASQKVTDVTLAVADYINPEHLNDFHKVYKNMEELRTRIVSGIIAPLGVPTEKAKKESQAEKKDPDSPLDYNPRGIPPRHPAGARAPSWPSPLNPFAVGGQDLDPLGGRSGGMIVDPLRSGFPQPGIDPSTGLPSGLPPGAVPPGARFDPFGPLGAGRAGPDPDHLPPPGYDDMFM", "length": 271 }, "evidence": [ { "id": "A0A0R4II16", "url": "https://omabrowser.org/oma/group/A0A0R4II16/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "Q8BHL8-1", "protein_name": "Proteasome inhibitor PI31 subunit", "gene_name": "Psmf1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAGLEVLFASAAPSMSCPQDALVCFLHWEVVTNGYYALGTGDQPGPSDKKSELLPAKWNSNKELYALRYESKDGARKLLLKAVSVENGMIINVLELGTQQVADLTLNLDDYIDAEDLSDFHRTYKNSEELRSQIRSGIITPIHEQWEKARANSPPREFPPATAREVDPLQISSHRPHTSRQPAWRDPLSPFAVGGDDLDPFGCQRGGMIVDPLRSGFPRVLIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL", "length": 271 }, "evidence": [ { "id": "MGI:1346072", "url": "https://alliancegenome.org/gene/MGI:1346072#orthology", "database": "AGR" }, { "id": "HGNC:9571", "url": "https://alliancegenome.org/gene/HGNC:9571#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-040718-282", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040718-282#orthology", "database": "AGR" }, { "id": "A0A0R4II16", "url": "https://omabrowser.org/oma/group/A0A0R4II16/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q92530-1", "protein_name": "Proteasome inhibitor PI31 subunit", "gene_name": "PSMF1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL", "length": 271 }, "evidence": [ { "id": "MGI:1346072", "url": "https://alliancegenome.org/gene/MGI:1346072#orthology", "database": "AGR" }, { "id": "HGNC:9571", "url": "https://alliancegenome.org/gene/HGNC:9571#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-040718-282", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040718-282#orthology", "database": "AGR" }, { "id": "A0A0R4II16", "url": "https://omabrowser.org/oma/group/A0A0R4II16/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9M330-1", "protein_name": "Probable proteasome inhibitor", "gene_name": "", "tax_id": 3702, "organism": "Arabidopsis thaliana", "sequence": { "sequence": "MANSQTVMAMIRLARPPFRNNHDKVAFAIHSSFVASGYILTATGRPAFADEALSSSSQNDVGIEGWNEFEGEYAFVYANPKKGSKKILVKCLAMDDKLLVDAIADGGAEPAHLEIKVGDYAEESNEGDYSAQFKNLDKLVTDLQSEIIDKLDGKPKPVASRAQSSSETNEEPRYYDDTPNPLGPQIHPSGVVVPPIPGNGGYSDLFPGPGAGMYPGRGGFGDGSMLVGPTDPRFFPFGDGSDRPGFMGPPHPGMPPPGARFDPYGPPGVPGFEPGRFTRQPPRGPGGGHPDLEHFPGGSDFI", "length": 302 }, "evidence": [ { "id": "A0A0R4II16", "url": "https://omabrowser.org/oma/group/A0A0R4II16/", "database": "OMA" } ], "glygen_name": "Arabidopsis", "common_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9V637-1", "protein_name": "Proteasome inhibitor PI31 subunit", "gene_name": "PI31", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MESGSTAKTGDFFYGWDLLYKTVKADVSKKSDLLIALVHFLLTKHYNFRCVGVGDDKTLPEEEGSELLPDSWNDDDTKYSLRYVHDKMLYLLLGHITEGSLLINLLDINTKKVSNICVEPETLVPEVKGGITTIMPSASEIVERYRRELLDPVFTGNSREVTTQTTNSPRPIGSDPDPLRIGEPRRGGSFIPSAFEPRPFGFPDVGRGDLDPLGRGGHGNLFSFPSRPNMGPGPVPRFDPFNPLNPNRPGQGGINPDHMRPPDWNPDYYM", "length": 270 }, "evidence": [ { "id": "MGI:1346072", "url": "https://alliancegenome.org/gene/MGI:1346072#orthology", "database": "AGR" }, { "id": "HGNC:9571", "url": "https://alliancegenome.org/gene/HGNC:9571#orthology", "database": "AGR" }, { "id": "A0A0R4II16", "url": "https://omabrowser.org/oma/group/A0A0R4II16/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "pmid": "" }, { "name": "proteasome complex", "id": "GO:0000502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000502", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "endopeptidase inhibitor activity", "id": "GO:0004866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004866", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "pmid": "" }, { "name": "proteasome binding", "id": "GO:0070628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070628", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "pmid": "" }, { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4II16", "url": "https://www.uniprot.org/uniprotkb/A0A0R4II16" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 107, "end_pos": 109, "annotation": "n_glycosylation_sequon" }, { "start_pos": 59, "end_pos": 61, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 107, "end_pos": 109 }, { "start_pos": 59, "end_pos": 61 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }