{ "uniprot_canonical_ac": "A0A0R4IDC4-1", "uniprot_ac": "A0A0R4IDC4", "uniprot_id": "A0A0R4IDC4_DANRE", "mass": { "chemical_mass": 8149.0, "monoisotopic_mass": 8149.0 }, "refseq": { "ac": "NP_001278829", "name": "uncharacterized protein LOC100334344 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278829" }, "gene_names": [ { "name": "si:ch211-195b11.3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4", "id": "A0A0R4IDC4" }, { "name": "si:ch211-195b11.3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278829", "id": "NP_001278829" } ], "protein_names": [ { "name": "Si:ch211-195b11.3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4/entry#names_and_taxonomy", "id": "A0A0R4IDC4" }, { "name": "Uncharacterized protein LOC100334344 precursor", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4/entry#names_and_taxonomy", "id": "A0A0R4IDC4" }, { "name": "pancreatic secretory trypsin inhibitor-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278829", "id": "NP_001278829" }, { "name": "uncharacterized protein LOC100334344 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278829", "id": "NP_001278829" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: EH451329.1, EH452886.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505371 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EB842398.1, EB769236.1, EB766055.1 and EH441449.1.", "evidence": [ { "database": "RefSeq", "id": "NP_001278829", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278829" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IDC4", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "si:ch211-195b11.3", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-141222-6", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-141222-6", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000100582", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000100582", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "100334344", "url": "https://www.ncbi.nlm.nih.gov/gene/100334344", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001239", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001239", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002350", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002350", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:100334344", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100334344", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WESNAKE", "url": "https://omabrowser.org/oma/group/WESNAKE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IDC4", "url": "https://www.orthodb.org/?gene=A0A0R4IDC4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21312", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21312", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21312:SF28", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21312:SF28", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00050", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00050", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001278829", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278829", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IDC4", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IDC4-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-141222-6", "url": "https://zfin.org/ZDB-GENE-141222-6", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MKLAILVCVSVVFYLTMVEAEATDESPIVCTREYKPVCGDDGITYSNECMLRWESNAKEVVVNVKHEGKCESS", "length": 73, "header": "tr|A0A0R4IDC4-1|A0A0R4IDC4_DANRE Isoform 1 of Si:ch211-195b11.3 OS=Danio rerio OX=7955 GN=si:ch211-195b11.3 PE=4 SV=1 CANONICAL=A0A0R4IDC4-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IDC4-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4/entry#A0A0R4IDC4-1", "sequence": { "sequence": "MKLAILVCVSVVFYLTMVEAEATDESPIVCTREYKPVCGDDGITYSNECMLRWESNAKEVVVNVKHEGKCESS", "length": 73, "header": "tr|A0A0R4IDC4-1|A0A0R4IDC4_DANRE Isoform 1 of Si:ch211-195b11.3 OS=Danio rerio OX=7955 GN=si:ch211-195b11.3 PE=4 SV=1 CANONICAL=A0A0R4IDC4-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2002", "authors": "Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IDC4", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4" } ], "reference": [ { "type": "PubMed", "id": "12477932", "url": "https://glygen.org/publication/PubMed/12477932" } ] }, { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IDC4", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Spatiotemporal Characterization of Anterior Segment Mesenchyme Heterogeneity During Zebrafish Ocular Anterior Segment Development.", "journal": "Front. Cell Dev. Biol.", "date": "2020", "authors": "Van Der Meulen Kristyn L, V\u00f6cking Oliver, Weaver Megan L, Meshram Nishita N, Famulski Jakub K", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IDC4", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4" } ], "reference": [ { "type": "PubMed", "id": "32528955", "url": "https://glygen.org/publication/PubMed/32528955" } ] } ], "pathway": [ { "id": "dre:100334344", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100334344", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "serine-type endopeptidase inhibitor activity", "id": "GO:0004867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004867", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IDC4", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IDC4", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IDC4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }