{ "uniprot_canonical_ac": "A0A0R4ID76-1", "uniprot_ac": "A0A0R4ID76", "uniprot_id": "A0A0R4ID76_DANRE", "mass": { "chemical_mass": 29727.0, "monoisotopic_mass": 29727.0 }, "refseq": {}, "gene_names": [ { "name": "cd79b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76", "id": "A0A0R4ID76" } ], "protein_names": [ { "name": "CD79b molecule, immunoglobulin-associated beta", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76/entry#names_and_taxonomy", "id": "A0A0R4ID76" }, { "name": "Uncharacterized protein cd79b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76/entry#names_and_taxonomy", "id": "A0A0R4ID76" } ], "function": [], "disease": [ { "disease_id": "DOID:0050745", "recommended_name": { "id": "DOID:0050745", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050745", "name": "diffuse large B-cell lymphoma", "description": "A large B-cell lymphoma that is consisting of medium-sized to large B cells with a diffuse growth pattern." }, "synonyms": [ { "id": "DOID:0050745", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050745", "name": "DLBCL", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "0050745", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050745" } ] }, { "disease_id": "DOID:0050746", "recommended_name": { "id": "DOID:0050746", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050746", "name": "mantle cell lymphoma", "description": "A B-cell lymphocytic neoplasm due to CD5 positive antigen-naive pregerminal center B-cell within the mantle zone that surrounds normal germinal center follicles." }, "synonyms": [], "unlinked_id_list": [], "evidence": [ { "id": "0050746", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050746" } ] }, { "disease_id": "DOID:0050750", "recommended_name": { "id": "DOID:0050750", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050750", "name": "splenic marginal zone lymphoma", "description": "A marginal zone B-cell lymphocyte located_in the spleen comprised of B-cells in place of white pulp." }, "synonyms": [], "unlinked_id_list": [], "evidence": [ { "id": "0050750", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050750" } ] }, { "disease_id": "DOID:0050873", "recommended_name": { "id": "DOID:0050873", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050873", "name": "follicular lymphoma", "description": "A B-cell lymphoma that is characterized as an indolent non-Hodgkin's lymphoma and has_material_basis_in follicle center B-cells (centrocytes and centroblasts)." }, "synonyms": [ { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "follicular lymphoma", "description": "Follicular lymphoma is a form of non-Hodgkin lymphoma characterized by a proliferation of B cells whose nodular structure of follicular architecture is preserved." }, { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "follicle center lymphoma", "description": "" }, { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "follicle centre lymphoma", "description": "" }, { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "follicular center cell lymphoma", "description": "" }, { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "follicular centre cell lymphoma", "description": "" }, { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "follicular non-Hodgkin lymphoma", "description": "" }, { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "follicular non-Hodgkin's lymphoma", "description": "" }, { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "lymphoma, follicular center cell", "description": "" }, { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "lymphoma, follicular centre cell", "description": "" }, { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "lymphoma, follicular, malignant", "description": "" }, { "id": "MONDO:0018906", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018906", "name": "lymphoma, follicular", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "0050873", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050873" } ] }, { "disease_id": "DOID:0060060", "recommended_name": { "id": "DOID:0060060", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060060", "name": "non-Hodgkin lymphoma", "description": "A lymphoma that is characterized as any kind of lymphoma except Hodgkin's lymphoma." }, "synonyms": [ { "id": "MONDO:0011508", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011508", "name": "lymphoma, non-Hodgkin, familial", "description": "" }, { "id": "MONDO:0011508", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011508", "name": "lymphoma, follicular, somatic", "description": "" }, { "id": "MONDO:0011508", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011508", "name": "lymphoma, non-Hodgkin", "description": "" }, { "id": "MONDO:0011508", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011508", "name": "lymphoma, non-Hodgkin, familial", "description": "" }, { "id": "MONDO:0011508", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011508", "name": "lymphoma, non-Hodgkin, somatic", "description": "" }, { "id": "MONDO:0011508", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011508", "name": "non-Hodgkin lymphoma", "description": "" }, { "id": "MIM:605027", "resource": "MIM", "url": "https://www.omim.org/entry/605027", "name": "Familial non-Hodgkin lymphoma", "description": "Familial non-Hodgkin lymphoma" } ], "unlinked_id_list": [ "DOID:706", "DOID:6536", "DOID:0081452" ], "evidence": [ { "id": "0060060", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060060" } ] }, { "disease_id": "DOID:0081138", "recommended_name": { "id": "DOID:0081138", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081138", "name": "agammaglobulinemia 6", "description": "An agammaglobulinemia that has_material_basis_in homozygous mutation in the CD79B gene on chromosome 17q23." }, "synonyms": [ { "id": "MONDO:0012987", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012987", "name": "agammaglobulinemia 6, autosomal recessive", "description": "Any autosomal agammaglobulinemia in which the cause of the disease is a mutation in the CD79B gene." }, { "id": "MONDO:0012987", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012987", "name": "CD79B autosomal agammaglobulinemia", "description": "" }, { "id": "MONDO:0012987", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012987", "name": "agammaglobulinemia 6, autosomal recessive", "description": "" }, { "id": "MONDO:0012987", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012987", "name": "autosomal agammaglobulinemia caused by mutation in CD79B", "description": "" }, { "id": "MONDO:0012987", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012987", "name": "AGM6", "description": "" }, { "id": "MONDO:0012987", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012987", "name": "agammaglobulinemia, autosomal recessive, due to Cd79B defect", "description": "" }, { "id": "MIM:612692", "resource": "MIM", "url": "https://www.omim.org/entry/612692", "name": "Agammaglobulinemia 6, autosomal recessive", "description": "Agammaglobulinemia 6, autosomal recessive" } ], "unlinked_id_list": [], "evidence": [ { "id": "0081138", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081138" } ] }, { "disease_id": "DOID:1040", "recommended_name": { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "chronic lymphocytic leukemia", "description": "A lymphocytic leukemia characterized by over production of B-cells and their accumulation in bone marrow and blood." }, "synonyms": [ { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "B-cell chronic lymphocytic leukaemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "B-cell chronic lymphocytic leukemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "CLL", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "chronic lymphatic leukaemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "chronic lymphatic leukemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "chronic lymphocytic leukaemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "lymphoplasmacytic leukaemia", "description": "" }, { "id": "DOID:1040", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1040", "name": "lymphoplasmacytic leukemia", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "leukemia, chronic lymphocytic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "leukemia, chronic lymphocytic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "leukemia, chronic lymphocytic, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "B-cell malignancy, low-grade", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "Clls2", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "disrupted in B-cell malignancy", "description": "" }, { "id": "MONDO:0007190", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007190", "name": "leukemia, chronic lymphocytic, B-cell", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphocytic leukemia", "description": "B-cell chronic lymphocytic leukemia (B-CLL) is a type of B-cell non-Hodgkin lymphoma, and the most common form of leukemia in Western countries, affecting elderly adults (mean age of 67 and 72 years) with a slight male predominance (1.7:1), and characterized by a highly variable clinical presentation that can include asymptomatic disease or non-specific B-symptoms such as unintentional weight loss, severe fatigue, fever (without evidence of infection), and night sweats as well as cervical lymphadenopathy, splenomegaly and frequent infections. Some patients can also develop autoimmune complications such as autoimmune hemolytic anemia or immune thrombocytopenia. The clinical course is extremely heterogeneous with survival ranging from a few months to several decades." }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B cell CLL", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B cell chronic lymphocytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B cell chronic lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B cell lymphocytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B cell lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-CLL", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell CLL", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphogenous leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphogenous leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphoid leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell chronic lymphoid leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell lymphocytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "B-cell lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "BCLL", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "CLL", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "Chronic Lymphocytic Leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic B-cell lymphocytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic B-cell lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphatic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphatic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphocytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphocytic leukaemia (CLL)", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphocytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphocytic leukemia (CLL)", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphogenous leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "chronic lymphogenous leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "hematopoeitic - chronic lymphocytic leukaemia (CLL)", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "hematopoeitic - chronic lymphocytic leukemia (CLL)", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "lymphoplasmacytic leukaemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "lymphoplasmacytic leukemia", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "leukemia, chronic LYMPHOCYTIC", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "leukemia, chronic lymphatic", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "leukemia, lymphocytic, chronic", "description": "" }, { "id": "MONDO:0004948", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0004948", "name": "small lymphocytic lymphoma", "description": "" }, { "id": "MONDO:0012936", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012936", "name": "leukemia, chronic lymphocytic, susceptibility to, 5", "description": "" }, { "id": "MONDO:0012936", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012936", "name": "leukemia, chronic lymphocytic susceptibility to, 5", "description": "" }, { "id": "MONDO:0012936", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012936", "name": "leukemia, chronic lymphocytic, susceptibility to, 5", "description": "" }, { "id": "MONDO:0012936", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012936", "name": "leukemia, chronic lymphocytic, susceptibility to, type 5", "description": "" }, { "id": "MONDO:0012936", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012936", "name": "Clls5", "description": "" }, { "id": "MONDO:0012935", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012935", "name": "leukemia, chronic lymphocytic, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012935", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012935", "name": "leukemia, chronic lymphocytic susceptibility to, 4", "description": "" }, { "id": "MONDO:0012935", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012935", "name": "leukemia, chronic lymphocytic, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012935", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012935", "name": "leukemia, chronic lymphocytic, susceptibility to, type 4", "description": "" }, { "id": "MONDO:0012935", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012935", "name": "Clls4", "description": "" }, { "id": "MONDO:0012934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012934", "name": "leukemia, chronic lymphocytic, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012934", "name": "leukemia, chronic lymphocytic, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012934", "name": "leukemia, chronic lymphocytic, susceptibility to, type 3", "description": "" }, { "id": "MONDO:0012934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012934", "name": "Clls3", "description": "" }, { "id": "MONDO:0012318", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012318", "name": "leukemia, chronic lymphocytic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0012318", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012318", "name": "leukemia, chronic lymphocytic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0012318", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012318", "name": "leukemia, chronic lymphocytic, susceptibility to, type 1", "description": "" }, { "id": "MONDO:0012318", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012318", "name": "Clls1", "description": "" }, { "id": "MIM:151400", "resource": "MIM", "url": "https://www.omim.org/entry/151400", "name": "Leukemia, chronic lymphocytic", "description": "Leukemia, chronic lymphocytic" } ], "unlinked_id_list": [ "DOID:1039" ], "evidence": [ { "id": "1040", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1040" } ] }, { "disease_id": "DOID:3234", "recommended_name": { "id": "DOID:3234", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3234", "name": "central nervous system lymphoma", "description": "A hematologic cancer that has_material_basis_in lymphoma located_in central nervous system." }, "synonyms": [ { "id": "DOID:3234", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3234", "name": "Microglioma", "description": "" }, { "id": "DOID:3234", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3234", "name": "primary CNS lymphoma", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "3234", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3234" } ] }, { "disease_id": "DOID:8584", "recommended_name": { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "Burkitt lymphoma", "description": "A mature B-cell neoplasm of B-cells found in the germinal center." }, "synonyms": [ { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "Burkitt lymphoma/leukaemia", "description": "" }, { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "Burkitt's Lymphoma", "description": "" }, { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "Burkitt's tumor", "description": "" }, { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "Burkitt's tumor or lymphoma", "description": "" }, { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "malignant lymphoma, Burkitt's type", "description": "" }, { "id": "DOID:8584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8584", "name": "small Non-Cleaved cell Lymphoma, Burkitt's type", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt lymphoma", "description": "A rare form of malignant mature B-cell non-Hodgkin lymphoma." }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt lymphoma", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt lymphoma/leukemia", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt's lymphoma", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt's tumor", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt's tumor or lymphoma", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt's tumour", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "Burkitt's tumour or lymphoma", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "burkitt lymphoma, somatic", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "malignant lymphoma, Burkitt's type", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "small non-cleaved cell lymphoma", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "small non-cleaved cell lymphoma, Burkitt's type", "description": "" }, { "id": "MONDO:0007243", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007243", "name": "BL", "description": "" }, { "id": "MIM:113970", "resource": "MIM", "url": "https://www.omim.org/entry/113970", "name": "Burkitt lymphoma", "description": "Burkitt lymphoma" } ], "unlinked_id_list": [], "evidence": [ { "id": "8584", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:8584" } ] }, { "disease_id": "DOID:9952", "recommended_name": { "id": "DOID:9952", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9952", "name": "acute lymphoblastic leukemia", "description": "A acute leukemia that is characterized by over production of lymphoblasts." }, "synonyms": [ { "id": "DOID:9952", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9952", "name": "acute lymphoblastic leukaemia", "description": "" }, { "id": "DOID:9952", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9952", "name": "acute lymphocytic leukaemia", "description": "" }, { "id": "DOID:9952", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9952", "name": "ALL", "description": "" }, { "id": "DOID:9952", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9952", "name": "precursor lymphoblastic lymphoma/leukemia", "description": "" }, { "id": "MONDO:0009539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009539", "name": "lymphoblastic leukemia, acute, with lymphomatous features", "description": "" }, { "id": "MONDO:0009539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009539", "name": "leukemia, acute lymphoblastic", "description": "" }, { "id": "MONDO:0009539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009539", "name": "lymphoblastic leukemia, acute, with lymphomatous features", "description": "" }, { "id": "MONDO:0009539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009539", "name": "lall", "description": "" }, { "id": "MONDO:0009539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009539", "name": "lymphomatous All", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, acute lymphocytic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "T-cell acute lymphoblastic leukemia, somatic", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, T-cell acute lymphoblastic, somatic", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, T-cell acute lymphocytic, somatic", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, acute lymphoblastic, somatic", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, acute lymphocytic, Philadelphia chromosome positive, somatic", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, acute lymphocytic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "ALL", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "All1", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, B-cell acute lymphoblastic, susceptibility to", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, T-cell acute lymphoblastic, susceptibility to", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, acute lymphoblastic", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, acute lymphoblastic, B-Hyperdiploid, susceptibility to", "description": "" }, { "id": "MONDO:0013108", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013108", "name": "leukemia, acute lymphoblastic, susceptibility to, 1", "description": "" }, { "id": "MIM:613065", "resource": "MIM", "url": "https://www.omim.org/entry/613065", "name": "Leukemia, acute lymphoblastic", "description": "Leukemia, acute lymphoblastic" } ], "unlinked_id_list": [ "DOID:0080638", "DOID:5604" ], "evidence": [ { "id": "9952", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9952" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ID76", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "cd79b", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-121219-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-121219-1", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000104691", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000104691", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00099", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00099", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100329481", "url": "https://www.ncbi.nlm.nih.gov/gene/100329481", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013151", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013151", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:100329481", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100329481", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PVHFICY", "url": "https://omabrowser.org/oma/group/PVHFICY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4ID76", "url": "https://www.orthodb.org/?gene=A0A0R4ID76", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14334", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14334", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14334:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14334:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00047", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00047", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_009304705", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_009304705", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4ID76", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4ID76-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M3AY10", "url": "https://www.uniprot.org/uniprotkb/A0A8M3AY10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8M3AY10-1", "url": "https://www.uniprot.org/uniprotkb/A0A8M3AY10-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-121219-1", "url": "https://zfin.org/ZDB-GENE-121219-1", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MSVLICMFLRSIFTALDLHLLAEAGLCSGELYSFCSLSVTDVYITFRGGFEDFNIMHHFLLGFSVMALIYLSAEGSIIVFQKPRFIGVKTGRTVIIYCVPSNPTRGPARVQWFKNKNYQSSLTNDQRITINDRNNDKNASITLKKVETEDSGTYVCKLNDTFGPGTALQVSRYSEPHAVLMRSRVKDVIIFLQAFLLVLCIVVPLVRLYKLEKKEEAEYEEPEDDHIYEGLEIEQVGGDVYEDISTFAQSSDAAWQVESPCQE", "length": 263, "header": "tr|A0A0R4ID76-1|A0A0R4ID76_DANRE Isoform 1 of CD79b molecule, immunoglobulin-associated beta OS=Danio rerio OX=7955 GN=cd79b PE=4 SV=1 CANONICAL=A0A0R4ID76-1" }, "isoforms": [ { "isoform_ac": "A0A0R4ID76-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76/entry#A0A0R4ID76-1", "sequence": { "sequence": "MSVLICMFLRSIFTALDLHLLAEAGLCSGELYSFCSLSVTDVYITFRGGFEDFNIMHHFLLGFSVMALIYLSAEGSIIVFQKPRFIGVKTGRTVIIYCVPSNPTRGPARVQWFKNKNYQSSLTNDQRITINDRNNDKNASITLKKVETEDSGTYVCKLNDTFGPGTALQVSRYSEPHAVLMRSRVKDVIIFLQAFLLVLCIVVPLVRLYKLEKKEEAEYEEPEDDHIYEGLEIEQVGGDVYEDISTFAQSSDAAWQVESPCQE", "length": 263, "header": "tr|A0A0R4ID76-1|A0A0R4ID76_DANRE Isoform 1 of CD79b molecule, immunoglobulin-associated beta OS=Danio rerio OX=7955 GN=cd79b PE=4 SV=1 CANONICAL=A0A0R4ID76-1" }, "locus": {} }, { "isoform_ac": "A0A8M3AY10-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76/entry#A0A8M3AY10-1", "sequence": { "sequence": "MSVLICMFLRSIFTASDLHLLAEAGLCSGELYSFCSLSVTDVYITFRGGFEDFNIMHHFLLGFSVMALIYLSAEGSIIVFQKPRFIGVKTGRTVIIYCVPSNPTRGPARVQWFKNKNYQSSLTNDQRITINDRNNDKNASITLKKVETEDSGTYVCKLNDTFGPGTELQVSRFSEPHAVLMRSRVKDVIIFLQAFLLVLCIVVPLVRLYKLEKKEEAEYEEPEDDHIYEGLEIEQVGGDVYEDISTFAQSSDAAWQVESPCQE", "length": 263, "header": "tr|A0A8M3AY10-1|A0A0R4ID76_DANRE Computationally mapped isoform of CD79b molecule, immunoglobulin-associated beta OS=Danio rerio OX=7955 GN=cd79b PE=4 SV=1 CANONICAL=A0A0R4ID76-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A8M3AY10", "url": "https://www.uniprot.org/uniprotkb/A0A8M3AY10" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] } ], "pathway": [ { "id": "dre:100329481", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100329481", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A4X1T0R0-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAGPALSPGLSNWLVLLLLLLSGETVLEAETKELRDPKGGACSRIWQHPRFVARKRGSMVEIRCYVEDPGIVSWLRKQEADLEPKIFPPEEGRIIQNQTTSEATLIIQGVQFQDNGVYYCKQECSKEPLRTEQGCGTELRVMGFSTLAQLKRRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKPGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE", "length": 228 }, "evidence": [ { "id": "A0A0R4ID76", "url": "https://omabrowser.org/oma/group/A0A0R4ID76/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A8J8XPU7-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "Cd79b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKLPSRVPGEMVPPLGLNLHGRKGPNGEEVERRKVAARADTQLHVLPQTLLGLRDRAVTMATLVLSPVPCHWLMFLLLLLSGEPVPAMTKSDQPPIFQGSPCSKIWQHPRFAAKKRSSMVKFHCHTDYSGVMTWFRQKGNQRPQELFPEDGHISQTRNGSVYTLTLQNIQYEDNGIYFCQQKCNSTEPDVTDGCGTELLVLGFSTLDQLKRRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE", "length": 287 }, "evidence": [ { "id": "RGD:620012", "url": "https://alliancegenome.org/gene/RGD:620012#orthology", "database": "AGR" }, { "id": "HGNC:1699", "url": "https://alliancegenome.org/gene/HGNC:1699#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-121219-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-121219-1#orthology", "database": "AGR" }, { "id": "MGI:96431", "url": "https://alliancegenome.org/gene/MGI:96431#orthology", "database": "AGR" }, { "id": "A0A0R4ID76", "url": "https://omabrowser.org/oma/group/A0A0R4ID76/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0AAA9SAP4-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MAGSALIPGLNNWLVLGLLLLSGEKVLADKTDDLLRDPKGNTCSRIWQHPRFVAKKRGSTVEIRCHVEDDGLVSWFRKPKPDSEPKTLHAEQGRILQSHNKSEAVLTILSVQFQDNGIYFCKQECAKGTQRTEHGCGTELRVMGFSTLAQLKRRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE", "length": 229 }, "evidence": [ { "id": "A0A0R4ID76", "url": "https://omabrowser.org/oma/group/A0A0R4ID76/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "P15530-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "Cd79b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE", "length": 228 }, "evidence": [ { "id": "RGD:620012", "url": "https://alliancegenome.org/gene/RGD:620012#orthology", "database": "AGR" }, { "id": "HGNC:1699", "url": "https://alliancegenome.org/gene/HGNC:1699#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-121219-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-121219-1#orthology", "database": "AGR" }, { "id": "MGI:96431", "url": "https://alliancegenome.org/gene/MGI:96431#orthology", "database": "AGR" }, { "id": "A0A0R4ID76", "url": "https://omabrowser.org/oma/group/A0A0R4ID76/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE", "length": 229 }, "evidence": [ { "id": "RGD:620012", "url": "https://alliancegenome.org/gene/RGD:620012#orthology", "database": "AGR" }, { "id": "HGNC:1699", "url": "https://alliancegenome.org/gene/HGNC:1699#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-121219-1", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-121219-1#orthology", "database": "AGR" }, { "id": "MGI:96431", "url": "https://alliancegenome.org/gene/MGI:96431#orthology", "database": "AGR" }, { "id": "A0A0R4ID76", "url": "https://omabrowser.org/oma/group/A0A0R4ID76/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q8AV16-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MGDFCRRLWVLQVNLWLMAVAAGGIPTDGNSTSNRTGSECVGMWQHPRYIAAKKNTSVHFICYTSQPHAMQWYKALGNGKEFHVLDQSSDRFSINNTNDRISFTISRISYEDNGIYVCDSKNLTEEKRQPNSCGTEIRVMSRSNIQQIQNRNTLKDTIIIIQTILLVIFISVPMLLFLEKGDRKERPEEDHTYEGLEVEQIATYEDITPFRDMKAKWTVGEHPGEE", "length": 226 }, "evidence": [ { "id": "A0A0R4ID76", "url": "https://omabrowser.org/oma/group/A0A0R4ID76/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ID76", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76" } ], "pmid": "" }, { "name": "B cell receptor complex", "id": "GO:0019815", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019815", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ID76", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "B cell receptor signaling pathway", "id": "GO:0050853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050853", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ID76", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76" } ], "pmid": "" }, { "name": "B cell differentiation", "id": "GO:0030183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030183", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4ID76", "url": "https://www.uniprot.org/uniprotkb/A0A0R4ID76" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 138, "end_pos": 140, "annotation": "n_glycosylation_sequon" }, { "start_pos": 159, "end_pos": 161, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 138, "end_pos": 140 }, { "start_pos": 159, "end_pos": 161 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }