{ "uniprot_canonical_ac": "A0A0R4IB86-1", "uniprot_ac": "A0A0R4IB86", "uniprot_id": "A0A0R4IB86_DANRE", "mass": { "chemical_mass": 28202.0, "monoisotopic_mass": 28202.0 }, "refseq": { "ac": "NP_001082865", "name": "uncharacterized protein LOC562337", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001082865" }, "gene_names": [ { "name": "si:dkeyp-53d3.3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86", "id": "A0A0R4IB86" }, { "name": "si:dkeyp-53d3.3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001082865", "id": "NP_001082865" } ], "protein_names": [ { "name": "Si:dkeyp-53d3.3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86/entry#names_and_taxonomy", "id": "A0A0R4IB86" }, { "name": "Uncharacterized protein LOC562337", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86/entry#names_and_taxonomy", "id": "A0A0R4IB86" }, { "name": "uncharacterized protein LOC562337", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001082865", "id": "NP_001082865" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: EH508472.1, BC135079.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA4476731, SAMEA4476739 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EH543780.1 and EH508472.1. On Jan 21, 2011 this sequence version replaced NP_001082865.1.", "evidence": [ { "database": "RefSeq", "id": "NP_001082865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001082865" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IB86", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "si:dkeyp-53d3.3", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-050208-644", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-050208-644", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000098664", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000098664", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "562337", "url": "https://www.ncbi.nlm.nih.gov/gene/562337", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:562337", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:562337", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NDLIQIM", "url": "https://omabrowser.org/oma/group/NDLIQIM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IB86", "url": "https://www.orthodb.org/?gene=A0A0R4IB86", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24399", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24399", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24399:SF54", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24399:SF54", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00096", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00096", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001082865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001082865", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4IB86", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IB86-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-050208-644", "url": "https://zfin.org/ZDB-GENE-050208-644", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MSKPQEHTCEEKTKCKTSFICTECGKNLSCKRTFTCHMRIHTGEGPYICTQCGKCLSSSETFKFHMMIHSGEKPYTCTQCGMIFRQSPSLRRHLLLHTGEKRHKCDQCGKTFLRGAQLKIHRRVHTNEKPYSCSECGKGFIRPAHLRRHEKTHTGVREYMCFQCEKTFVTAGALKRHQMTHTGEKPYKCAHCDKLFTRTEHLKVHMRIHTGEKPCTCTRCGTSFAQLASLKYHMRSHTGEKQPE", "length": 244, "header": "tr|A0A0R4IB86-1|A0A0R4IB86_DANRE Isoform 1 of Si:dkeyp-53d3.3 OS=Danio rerio OX=7955 GN=si:dkeyp-53d3.3 PE=3 SV=1 CANONICAL=A0A0R4IB86-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IB86-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86/entry#A0A0R4IB86-1", "sequence": { "sequence": "MSKPQEHTCEEKTKCKTSFICTECGKNLSCKRTFTCHMRIHTGEGPYICTQCGKCLSSSETFKFHMMIHSGEKPYTCTQCGMIFRQSPSLRRHLLLHTGEKRHKCDQCGKTFLRGAQLKIHRRVHTNEKPYSCSECGKGFIRPAHLRRHEKTHTGVREYMCFQCEKTFVTAGALKRHQMTHTGEKPYKCAHCDKLFTRTEHLKVHMRIHTGEKPCTCTRCGTSFAQLASLKYHMRSHTGEKQPE", "length": 244, "header": "tr|A0A0R4IB86-1|A0A0R4IB86_DANRE Isoform 1 of Si:dkeyp-53d3.3 OS=Danio rerio OX=7955 GN=si:dkeyp-53d3.3 PE=3 SV=1 CANONICAL=A0A0R4IB86-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IB86", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Gene evolution and gene expression after whole genome duplication in fish: the PhyloFish database.", "journal": "BMC Genomics", "date": "2016", "authors": "Pasquier Jeremy, Cabau C\u00e9dric, Nguyen Thaovi, Jouanno Elodie, Severac Dany, Braasch Ingo, Journot Laurent, Pontarotti Pierre, Klopp Christophe, Postlethwait John H, Guiguen Yann, Bobe Julien", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IB86", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86" } ], "reference": [ { "type": "PubMed", "id": "27189481", "url": "https://glygen.org/publication/PubMed/27189481" } ] } ], "pathway": [ { "id": "dre:562337", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:562337", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IB86", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IB86", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IB86", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IB86", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IB86", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IB86" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 27, "end_pos": 29, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 27, "end_pos": 29 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }