{ "uniprot_canonical_ac": "A0A0R4IAD0-1", "uniprot_ac": "A0A0R4IAD0", "uniprot_id": "A0A0R4IAD0_DANRE", "mass": { "chemical_mass": 48785.0, "monoisotopic_mass": 48785.0 }, "refseq": {}, "gene_names": [ { "name": "kcnj5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0", "id": "A0A0R4IAD0" } ], "protein_names": [ { "name": "G protein-activated inward rectifier potassium channel 4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0/entry#names_and_taxonomy", "id": "A0A0R4IAD0" }, { "name": "Potassium inwardly rectifying channel subfamily J member 5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0/entry#names_and_taxonomy", "id": "A0A0R4IAD0" } ], "function": [], "disease": [ { "disease_id": "DOID:0060224", "recommended_name": { "id": "DOID:0060224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060224", "name": "atrial fibrillation", "description": "A heart conduction disease that is characterized by uncoordinated electrical activity in the heart's upper chambers (the atria), which causes the heartbeat to become fast and irregular and has symptoms palpitations, weakness, fatigue, lightheadedness, dizziness, confusion, shortness of breath and chest pain." }, "synonyms": [ { "id": "DOID:0060224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060224", "name": "A-fib", "description": "" }, { "id": "DOID:0060224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060224", "name": "AFib", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "0060224", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060224" } ] }, { "disease_id": "DOID:0110654", "recommended_name": { "id": "DOID:0110654", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110654", "name": "long QT syndrome 13", "description": "A long QT syndrome that has_material_basis_in dominant inheritance of mutation in the KCNJ5 gene on chromosome 11q24.3." }, "synonyms": [ { "id": "DOID:0110654", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110654", "name": "LQT13", "description": "" }, { "id": "MONDO:0013279", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013279", "name": "long QT syndrome 13", "description": "Any long QT syndrome in which the cause of the disease is a mutation in the KCNJ5 gene." }, { "id": "MONDO:0013279", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013279", "name": "KCNJ5 long QT syndrome", "description": "" }, { "id": "MONDO:0013279", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013279", "name": "LQT13", "description": "" }, { "id": "MONDO:0013279", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013279", "name": "long QT syndrome 13", "description": "" }, { "id": "MONDO:0013279", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013279", "name": "long QT syndrome caused by mutation in KCNJ5", "description": "" }, { "id": "MONDO:0013279", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013279", "name": "long QT syndrome type 13", "description": "" }, { "id": "MIM:613485", "resource": "MIM", "url": "https://www.omim.org/entry/613485", "name": "Long QT syndrome 13", "description": "Long QT syndrome 13" } ], "unlinked_id_list": [], "evidence": [ { "id": "0110654", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110654" } ] }, { "disease_id": "DOID:446", "recommended_name": { "id": "DOID:446", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:446", "name": "primary hyperaldosteronism", "description": "An adrenal gland hyperfunction disease that results in the overproduction of aldosterone by the adrenal glands." }, "synonyms": [ { "id": "DOID:446", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:446", "name": "Cushing syndrome", "description": "" }, { "id": "DOID:446", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:446", "name": "Cushing's syndrome", "description": "" }, { "id": "DOID:446", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:446", "name": "hyperaldosteronism", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "familial hyperaldosteronism type III", "description": "Familial hyperaldosteronism type III (FH-III) is a rare heritable form of primary aldosteronism (PA) that is characterized by early-onset severe hypertension, non glucocorticoid-remediable hyperaldosteronism, overproduction of 18-oxocortisol and 18-hydroxycortisol, and profound hypokalemia." }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "FH-III", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "FH3", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "familial hyperaldosteronism type 3", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "FH 3", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "FH III", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "HALD3", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "hyperaldosteronism, familial, type 3", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "hyperaldosteronism, familial, type III", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "familial hyperaldosteronism type II", "description": "Familial hyperaldosteronism type II (FH-II) is a heritable form of primary aldosteronism (PA) characterized by hypertension of varying severity, and non glucocticoid remediable hyperaldosteronism." }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "FH-II", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "FH2", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "familial adrenal adenoma", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "familial hyperaldosteronism type 2", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "FH 2", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "FHII", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "HALD2", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "hyperaldosteronism, familial, type II", "description": "" }, { "id": "MIM:613677", "resource": "MIM", "url": "https://www.omim.org/entry/613677", "name": "Hyperaldosteronism, familial, 3", "description": "Hyperaldosteronism, familial, 3" }, { "id": "MIM:605635", "resource": "MIM", "url": "https://www.omim.org/entry/605635", "name": "Hyperaldosteronism, familial, 2", "description": "Hyperaldosteronism, familial, 2" } ], "unlinked_id_list": [ "DOID:0111622" ], "evidence": [ { "id": "446", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:446" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IAD0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "kcnj5", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-120215-97", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-120215-97", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000061014", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000061014", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "571888", "url": "https://www.ncbi.nlm.nih.gov/gene/571888", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013518", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013518", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014756", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014756", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016449", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016449", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040445", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040445", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041647", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041647", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:571888", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:571888", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SHEINAK", "url": "https://omabrowser.org/oma/group/SHEINAK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0R4IAD0", "url": "https://www.orthodb.org/?gene=A0A0R4IAD0", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11767", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11767", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11767:SF52", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11767:SF52", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01007", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01007", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17655", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17655", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_017207639", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017207639", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "29463", "url": "https://www.rhea-db.org/rhea/29463", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0R4IAD0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4IAD0-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-120215-97", "url": "https://zfin.org/ZDB-GENE-120215-97", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MAGDSRVHMDHDMEIGVTPREQVKKLPKHLRESQIPTDRTHLISDPVKKPRQRYVQKDGKCNVHHGNVKETYRYLSDLFTTLVDLRWRLSFFIFTLVYVVNWLFFGFLWWLIALIRGDLLHSDEEGWTPCVENLNSFVSAFLFSIETETTIGYGYRVITEKCPEGIILLMVQAILGSIVNAMMVGCMFVKISQPKNRAETLMFSHNAVISVRDNKMCLMFRVGDLRNSHIVEASIRAKLIRSQQTKEGEFIPLNQTDINIGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQMEKEEFEIVVILEGMVEATGMTCQARSSYLDSEVLWGFRFTPVLSLEKGFYEVDYNNFHDIYETNTPTCSAKELSARLKESPLLPHLPLLSPDLRAHTTDPFQTTEDQAKHDADTPPETNNGSANRLEENP", "length": 425, "header": "tr|A0A0R4IAD0-1|A0A0R4IAD0_DANRE Isoform 1 of G protein-activated inward rectifier potassium channel 4 OS=Danio rerio OX=7955 GN=kcnj5 PE=3 SV=2 CANONICAL=A0A0R4IAD0-1" }, "isoforms": [ { "isoform_ac": "A0A0R4IAD0-1", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0/entry#A0A0R4IAD0-1", "sequence": { "sequence": "MAGDSRVHMDHDMEIGVTPREQVKKLPKHLRESQIPTDRTHLISDPVKKPRQRYVQKDGKCNVHHGNVKETYRYLSDLFTTLVDLRWRLSFFIFTLVYVVNWLFFGFLWWLIALIRGDLLHSDEEGWTPCVENLNSFVSAFLFSIETETTIGYGYRVITEKCPEGIILLMVQAILGSIVNAMMVGCMFVKISQPKNRAETLMFSHNAVISVRDNKMCLMFRVGDLRNSHIVEASIRAKLIRSQQTKEGEFIPLNQTDINIGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQMEKEEFEIVVILEGMVEATGMTCQARSSYLDSEVLWGFRFTPVLSLEKGFYEVDYNNFHDIYETNTPTCSAKELSARLKESPLLPHLPLLSPDLRAHTTDPFQTTEDQAKHDADTPPETNNGSANRLEENP", "length": 425, "header": "tr|A0A0R4IAD0-1|A0A0R4IAD0_DANRE Isoform 1 of G protein-activated inward rectifier potassium channel 4 OS=Danio rerio OX=7955 GN=kcnj5 PE=3 SV=2 CANONICAL=A0A0R4IAD0-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IAD0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] } ], "pathway": [ { "id": "dre:571888", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:571888", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0B4KH86-1", "protein_name": "Inwardly rectifying potassium channel 1, isoform G", "gene_name": "Irk1", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MPKMIVDKSELVGENAWAKLLPDEKDKAIIVKMNKSSSNNNDSKETTPLNVDQLVAASNPAVAGEQSAVCLEDTYKRTSTYASNINSTGGESSGSGTQLSRKESILGSFHRQIRRSIKAVSESPGPLTRYRQTRFSSRRVRKRVVFKHGECNVVQGNVAKRRRRYLQDIFTTLVDAQWRWTLLVFAASFVFSWAFFGFIWWIIAYAHNDLEYTNLKNQSPDLVANITHTVCVTQVSNMMSAFLYSVETQTTIGYGNRYVTEECPEAIFTMCIQCITGVFIQAFMVGIVFAKLSRPKKRAQTLLFSRNAVICHRDGVPCLMFRVGDMRKSHIIEAHVRAQIIRKKVTKEGEVLPFYQQELHIGADGGEDRLMFIWPTTIVHKIDRNSPLYMLSASDMLKERFEVVVMLEGVIESTGMTTQARSSYLPSEVLWGHRFVNVVSFRKETGEYEVDYTLFNNTYDVDTPLCSAKQLDELKSEYSKSAKCVNAPFADRTLSASLFQRIASAASVDHLDPASDESLDSGRLQIRSHSIPNGVLASELEPLNNNKHGASFTMGGLTITTTAPSIPNLSSINEKTNSGNSINSSNYSNNNSLSTLTGGGSAASGPGGGITIVAGSGNHGGAGGGGGGGGRHKSNPRRLSIKQDQLPIDSIC", "length": 652 }, "evidence": [ { "id": "MGI:104755", "url": "https://alliancegenome.org/gene/MGI:104755#orthology", "database": "AGR" }, { "id": "HGNC:6266", "url": "https://alliancegenome.org/gene/HGNC:6266#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48544-1", "protein_name": "G protein-activated inward rectifier potassium channel 4", "gene_name": "KCNJ5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV", "length": 419 }, "evidence": [ { "id": "MGI:104755", "url": "https://alliancegenome.org/gene/MGI:104755#orthology", "database": "AGR" }, { "id": "HGNC:6266", "url": "https://alliancegenome.org/gene/HGNC:6266#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-120215-97", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-120215-97#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P48545-1", "protein_name": "G protein-activated inward rectifier potassium channel 4", "gene_name": "Kcnj5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAGDSRNAMNQDMEIGVTSQDHKKIPKQARDYIPIATDRTRLLTEGKKPRQRYMEKTGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYVRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLEQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKRSGRLLQYLPSPPLLGGCAEAGNEAEAEKDEEGEPNGLSVSQATRGSM", "length": 419 }, "evidence": [ { "id": "MGI:104755", "url": "https://alliancegenome.org/gene/MGI:104755#orthology", "database": "AGR" }, { "id": "HGNC:6266", "url": "https://alliancegenome.org/gene/HGNC:6266#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-120215-97", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-120215-97#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P48548-1", "protein_name": "G protein-activated inward rectifier potassium channel 4", "gene_name": "Kcnj5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAGDSRNAMNQDMEIGVTSQDHKKIPKQARDYIPIATDRTRLLPEGKKPRQRYMEKTGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYVRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLEQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKRNGQLLQSLPSPPLLGGCAEAEKEAEAEHDEEEEPNGLSVSRATRGSM", "length": 419 }, "evidence": [ { "id": "MGI:104755", "url": "https://alliancegenome.org/gene/MGI:104755#orthology", "database": "AGR" }, { "id": "HGNC:6266", "url": "https://alliancegenome.org/gene/HGNC:6266#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IAD0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0" } ], "pmid": "" }, { "name": "monoatomic ion channel complex", "id": "GO:0034702", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034702", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IAD0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IAD0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0" } ], "pmid": "" }, { "name": "regulation of monoatomic ion transmembrane transport", "id": "GO:0034765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034765", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IAD0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0" } ], "pmid": "" }, { "name": "potassium ion import across plasma membrane", "id": "GO:1990573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990573", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IAD0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "inward rectifier potassium channel activity", "id": "GO:0005242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005242", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4IAD0", "url": "https://www.uniprot.org/uniprotkb/A0A0R4IAD0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 254, "end_pos": 256, "annotation": "n_glycosylation_sequon" }, { "start_pos": 415, "end_pos": 417, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "29463", "name": "", "equation": "K(+)(in) = K(+)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0AB32T5S6-1" ], "evidence": [ { "id": "29463", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/29463" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0AB32T5S6", "gene_name": "kcnk4a", "activity": [ { "ec_number": "2.7.11.1", "activity": "L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+).", "evidence": [ { "id": "A0AB32T5S6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AB32T5S6" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "A0AB32T5S6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AB32T5S6" } ] } ] } ], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 254, "end_pos": 256 }, { "start_pos": 415, "end_pos": 417 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }