{ "uniprot_canonical_ac": "A0A0N4SUI7-1", "uniprot_ac": "A0A0N4SUI7", "uniprot_id": "A0A0N4SUI7_MOUSE", "mass": { "chemical_mass": 7026.0, "monoisotopic_mass": 7026.0 }, "refseq": {}, "gene_names": [ { "name": "Nbdy", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7", "id": "A0A0N4SUI7" }, { "name": "2210013O21Rik", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7", "id": "A0A0N4SUI7" } ], "protein_names": [ { "name": "Negative regulator of P-body association", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7/entry#names_and_taxonomy", "id": "A0A0N4SUI7" } ], "function": [], "disease": [], "snv": [ { "evidence": [ { "id": "rs3411959550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3411959550" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 40, "end_pos": 40, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "X", "chr_pos": "152506814", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T40", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A0N4SUI7", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Nbdy", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7", "locus": { "chromosome": "X", "start_pos": 152524916, "end_pos": 152506586, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000086316", "url": "https://www.ensembl.org/id/ENSMUSG00000086316" } ] } } ], "crossref": [ { "id": "MGI:1917373", "url": "https://alliancegenome.org/gene/MGI:1917373", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSMUSG00000086316", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000086316", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20243", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20243", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "70123", "url": "https://www.ncbi.nlm.nih.gov/gene/70123", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR047852", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047852", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:70123", "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:70123", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1917373", "url": "http://www.informatics.jax.org/marker/MGI:1917373", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "DQPCVSG", "url": "https://omabrowser.org/oma/group/DQPCVSG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0N4SUI7", "url": "https://www.orthodb.org/?gene=A0A0N4SUI7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A140LJI0", "url": "https://www.orthodb.org/?gene=A0A140LJI0", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF21949", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF21949", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A0N4SUI7", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0N4SUI7-1", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LJI0", "url": "https://www.uniprot.org/uniprotkb/A0A140LJI0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LJI0-1", "url": "https://www.uniprot.org/uniprotkb/A0A140LJI0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGDQPCASGRSTLPPGNTREPKPPKKRCVLAPRWDYPEGTPSGGSSTLPSAPPPASAGLKSHPPPPEK", "length": 68, "header": "tr|A0A0N4SUI7-1|A0A0N4SUI7_MOUSE Isoform 1 of Negative regulator of P-body association OS=Mus musculus OX=10090 GN=Nbdy PE=1 SV=1 CANONICAL=A0A0N4SUI7-1" }, "isoforms": [ { "isoform_ac": "A0A0N4SUI7-1", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7/entry#A0A0N4SUI7-1", "sequence": { "sequence": "MGDQPCASGRSTLPPGNTREPKPPKKRCVLAPRWDYPEGTPSGGSSTLPSAPPPASAGLKSHPPPPEK", "length": 68, "header": "tr|A0A0N4SUI7-1|A0A0N4SUI7_MOUSE Isoform 1 of Negative regulator of P-body association OS=Mus musculus OX=10090 GN=Nbdy PE=1 SV=1 CANONICAL=A0A0N4SUI7-1" }, "locus": { "chromosome": "X", "start_pos": 152512134, "end_pos": 152511931, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000149514.8", "url": "https://www.ensembl.org/id/ENSMUST00000149514.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145010.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145010.2" } ] } }, { "isoform_ac": "A0A140LJI0-1", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7/entry#A0A140LJI0-1", "sequence": { "sequence": "MLKAHLIFSTPLTISLFDCATWRPYLQTEYYDVMTVISPPEFG", "length": 43, "header": "tr|A0A140LJI0-1|A0A0N4SUI7_MOUSE Computationally mapped isoform of Negative regulator of P-body association OS=Mus musculus OX=10090 GN=Nbdy PE=1 SV=1 CANONICAL=A0A0N4SUI7-1" }, "locus": { "chromosome": "X", "start_pos": 152524077, "end_pos": 152508829, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000208235.2", "url": "https://www.ensembl.org/id/ENSMUST00000208235.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000147221.2", "url": "https://www.ensembl.org/id/ENSMUSP00000147221.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 40, "start_aa": "Thr", "end_pos": 40, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr40", "evidence": [ { "id": "GLY_001153", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001153" } ], "filter_code": "00000000000000001000.00000000001000.0.xxxxx" } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Modernizing reference genome assemblies.", "journal": "PLoS Biol.", "date": "2011", "authors": "Church Deanna M, Schneider Valerie A, Graves Tina, Auger Katherine, Cunningham Fiona, Bouk Nathan, Chen Hsiu-Chuan, Agarwala Richa, McLaren William M, Ritchie Graham R S, Albracht Derek, Kremitzki Milinn, Rock Susan, Kotkiewicz Holland, Kremitzki Colin, Wollam Aye, Trani Lee, Fulton Lucinda, Fulton Robert, Matthews Lucy, Whitehead Siobhan, Chow Will, Torrance James, Dunn Matthew, Harden Glenn, Threadgold Glen, Wood Jonathan, Collins Joanna, Heath Paul, Griffiths Guy, Pelan Sarah, Grafham Darren, Eichler Evan E, Weinstock George, Mardis Elaine R, Wilson Richard K, Howe Kerstin, Flicek Paul, Hubbard Tim", "evidence": [ { "database": "UniProtKB", "id": "A0A140LJI0", "url": "https://www.uniprot.org/uniprotkb/A0A140LJI0" } ], "reference": [ { "type": "PubMed", "id": "21750661", "url": "https://glygen.org/publication/PubMed/21750661" } ] } ], "pathway": [ { "id": "mmu:70123", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:70123", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0U1RRE5-1", "protein_name": "Negative regulator of P-body association", "gene_name": "NBDY", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK", "length": 68 }, "evidence": [ { "id": "MGI:1917373", "url": "https://alliancegenome.org/gene/MGI:1917373#orthology", "database": "AGR" }, { "id": "HGNC:50713", "url": "https://alliancegenome.org/gene/HGNC:50713#orthology", "database": "AGR" }, { "id": "A0A0N4SUI7", "url": "https://omabrowser.org/oma/group/A0A0N4SUI7/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "A0A3Q1LS02-1", "protein_name": "Negative regulator of P-body association", "gene_name": "NBDY", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MGDQPCTSGRSTLPPGNTRETKPPKKRCLLAPRWDYPEGTANGGNTTLPSTPPPASPGLKSHPPPPEK", "length": 68 }, "evidence": [ { "id": "A0A0N4SUI7", "url": "https://omabrowser.org/oma/group/A0A0N4SUI7/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "A0A4X1VGD9-1", "protein_name": "Negative regulator of P-body association", "gene_name": "NBDY", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MGDQPCASGRSTLPPGNTRETKPPKKRCLLAPRWDYPEGTPNGGSTPLPSAPTPASPGLKSHPPPPEK", "length": 68 }, "evidence": [ { "id": "A0A0N4SUI7", "url": "https://omabrowser.org/oma/group/A0A0N4SUI7/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "P-body", "id": "GO:0000932", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000932", "evidence": [ { "database": "UniProtKB", "id": "A0A0N4SUI7", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "nuclear-transcribed mRNA catabolic process", "id": "GO:0000956", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000956", "evidence": [ { "database": "UniProtKB", "id": "A0A0N4SUI7", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7" } ], "pmid": "" }, { "name": "negative regulation of cytoplasmic mRNA processing body assembly", "id": "GO:0010607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010607", "evidence": [ { "database": "UniProtKB", "id": "A0A0N4SUI7", "url": "https://www.uniprot.org/uniprotkb/A0A0N4SUI7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 40 ], "snv_sites": [ 40 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }