{ "uniprot_canonical_ac": "A0A0H2UI11-1", "uniprot_ac": "A0A0H2UI11", "uniprot_id": "A0A0H2UI11_RAT", "mass": { "chemical_mass": 6254.0, "monoisotopic_mass": 6254.0 }, "refseq": { "ac": "XP_038956522", "name": "large ribosomal subunit protein eL39-like", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_038956522" }, "gene_names": [ { "name": "Rpl39l2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11", "id": "A0A0H2UI11" }, { "name": "LOC103690889", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11", "id": "A0A0H2UI11" }, { "name": "Rpl39l2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_038956522", "id": "XP_038956522" } ], "protein_names": [ { "name": "Ribosomal protein L39 like 2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11/entry#names_and_taxonomy", "id": "A0A0H2UI11" }, { "name": "large ribosomal subunit protein eL39-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_038956522", "id": "XP_038956522" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0H2UI11", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Rpl39l2", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11", "locus": { "chromosome": "X", "start_pos": 106046348, "end_pos": 106046503, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000066509", "url": "https://www.ensembl.org/id/ENSRNOG00000066509" } ] } } ], "crossref": [ { "id": "RGD:9146728", "url": "https://alliancegenome.org/gene/RGD:9146728", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A0H2UI11", "url": "https://alphafold.ebi.ac.uk/entry/A0A0H2UI11", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000043348", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000043348", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "103690889", "url": "https://www.ncbi.nlm.nih.gov/gene/103690889", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000077", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000077", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023626", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023626", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "HKIFRIR", "url": "https://omabrowser.org/oma/group/HKIFRIR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR19970", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19970", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19970:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19970:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00832", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00832", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_038956522", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_038956522", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "9146728", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=9146728", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0H2UI11", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0H2UI11-1", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSHMTFRIKLFLAKKQKQNRPIPQWIQMKTGNKIRFNSKRRHWRSTKLGL", "length": 51, "header": "tr|A0A0H2UI11-1|A0A0H2UI11_RAT Isoform 1 of Ribosomal protein L39 like 2 OS=Rattus norvegicus OX=10116 GN=Rpl39l2 PE=3 SV=2 CANONICAL=A0A0H2UI11-1" }, "isoforms": [ { "isoform_ac": "A0A0H2UI11-1", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11/entry#A0A0H2UI11-1", "sequence": { "sequence": "MSSHMTFRIKLFLAKKQKQNRPIPQWIQMKTGNKIRFNSKRRHWRSTKLGL", "length": 51, "header": "tr|A0A0H2UI11-1|A0A0H2UI11_RAT Isoform 1 of Ribosomal protein L39 like 2 OS=Rattus norvegicus OX=10116 GN=Rpl39l2 PE=3 SV=2 CANONICAL=A0A0H2UI11-1" }, "locus": { "chromosome": "X", "start_pos": 106046503, "end_pos": 106046351, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000064521.3", "url": "https://www.ensembl.org/id/ENSRNOT00000064521.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000059662.3", "url": "https://www.ensembl.org/id/ENSRNOP00000059662.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "translation", "id": "GO:0006412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006412", "evidence": [ { "database": "UniProtKB", "id": "A0A0H2UI11", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "structural constituent of ribosome", "id": "GO:0003735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003735", "evidence": [ { "database": "UniProtKB", "id": "A0A0H2UI11", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytosolic large ribosomal subunit", "id": "GO:0022625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022625", "evidence": [ { "database": "UniProtKB", "id": "A0A0H2UI11", "url": "https://www.uniprot.org/uniprotkb/A0A0H2UI11" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0H2UI11-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 51, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0H2UI11-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A0H2UI11" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }