{ "uniprot_canonical_ac": "A0A0G2L2Q2-1", "uniprot_ac": "A0A0G2L2Q2", "uniprot_id": "A0A0G2L2Q2_DANRE", "mass": { "chemical_mass": 7222.0, "monoisotopic_mass": 7222.0 }, "refseq": { "ac": "NP_001289407", "name": "cytochrome b-c1 complex subunit 9", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289407" }, "gene_names": [ { "name": "uqcr10", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2", "id": "A0A0G2L2Q2" }, { "name": "uqcr10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289407", "id": "NP_001289407" } ], "protein_names": [ { "name": "Complex III subunit 9", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2/entry#names_and_taxonomy", "id": "A0A0G2L2Q2" }, { "name": "TCONS_00052125", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289407", "id": "NP_001289407" }, { "name": "cytochrome b-c1 complex subunit 9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289407", "id": "NP_001289407" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: EH435283.1, EH503399.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505371 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EH435283.1 and EH490607.1. On Oct 22, 2014 this sequence version replaced XP_003200865.1.", "evidence": [ { "database": "RefSeq", "id": "NP_001289407", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289407" } ] }, { "annotation": "Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The complex plays an important role in the uptake of multiple carbon sources present in different host niches.", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2#function" }, { "database": "UniProtKB", "id": "RU368056", "url": "https://www.uniprot.org/uniprotkb/RU368056#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "uqcr10", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2", "locus": {} } ], "crossref": [ { "id": "ZFIN:ZDB-GENE-170406-3", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-170406-3", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSDARG00000104517", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000104517", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "100333064", "url": "https://www.ncbi.nlm.nih.gov/gene/100333064", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR008027", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008027", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036656", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036656", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:100333064", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100333064", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IKHKYEV", "url": "https://omabrowser.org/oma/group/IKHKYEV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0G2L2Q2", "url": "https://www.orthodb.org/?gene=A0A0G2L2Q2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12980", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12980", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12980:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12980:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05365", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF05365", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001289407", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289407", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2L2Q2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "ZDB-GENE-170406-3", "url": "https://zfin.org/ZDB-GENE-170406-3", "database": "ZFIN", "categories": [ "Protein", "Organism-specific" ] } ], "sequence": { "sequence": "MALSKTVYNLLFRRSSTFAVTVVVGAVFFERLFDQGGNALFESINRGKLWKHIKHNYEQKEE", "length": 62, "header": "tr|A0A0G2L2Q2-1|A0A0G2L2Q2_DANRE Isoform 1 of Complex III subunit 9 OS=Danio rerio OX=7955 GN=uqcr10 PE=1 SV=1 CANONICAL=A0A0G2L2Q2-1" }, "isoforms": [ { "isoform_ac": "A0A0G2L2Q2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2/entry#A0A0G2L2Q2-1", "sequence": { "sequence": "MALSKTVYNLLFRRSSTFAVTVVVGAVFFERLFDQGGNALFESINRGKLWKHIKHNYEQKEE", "length": 62, "header": "tr|A0A0G2L2Q2-1|A0A0G2L2Q2_DANRE Isoform 1 of Complex III subunit 9 OS=Danio rerio OX=7955 GN=uqcr10 PE=1 SV=1 CANONICAL=A0A0G2L2Q2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] }, { "title": "Evolution of complexity in the zebrafish synapse proteome.", "journal": "Nat. Commun.", "date": "2017", "authors": "Bayes A, Collins MO, Reig-Viader R, Gou G, Goulding D, Izquierdo A, Choudhary JS, Emes RD, Grant SG", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2" } ], "reference": [ { "type": "PubMed", "id": "28252024", "url": "https://glygen.org/publication/PubMed/28252024" } ] }, { "title": "Systematic identification and characterization of cardiac long intergenic noncoding RNAs in zebrafish.", "journal": "Sci. Rep.", "date": "2017", "authors": "Wang Lei, Ma Xiao, Xu Xiaolei, Zhang Yuji", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2" } ], "reference": [ { "type": "PubMed", "id": "28455512", "url": "https://glygen.org/publication/PubMed/28455512" } ] }, { "title": "Aclonifen causes developmental abnormalities in zebrafish embryos through mitochondrial dysfunction and oxidative stress.", "journal": "Sci. Total Environ.", "date": "2021", "authors": "Lee Jin-Young, Park Hahyun, Lim Whasun, Song Gwonhwa", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2" } ], "reference": [ { "type": "PubMed", "id": "33548715", "url": "https://glygen.org/publication/PubMed/33548715" } ] }, { "title": "Flavin Adenine Dinucleotide Depletion Caused by electron transfer flavoprotein subunit alpha Haploinsufficiency Leads to Hepatic Steatosis and Injury in Zebrafish.", "journal": "Hepatol Commun", "date": "2021", "authors": "Park Ki-Hoon, Gooz Monika, Ye Zhi-Wei, Zhang Jie, Beeson Gyda C, Rockey Don C, Kim Seok-Hyung", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2" } ], "reference": [ { "type": "PubMed", "id": "34141984", "url": "https://glygen.org/publication/PubMed/34141984" } ] }, { "title": "Depletion of stearoyl-CoA desaturase (scd) leads to fatty liver disease and defective mating behavior in zebrafish.", "journal": "Zool. Res.", "date": "2023", "authors": "Xu Shan-Shan, Li Yi, Wang Hou-Peng, Chen Wen-Bo, Wang Ya-Qing, Song Zi-Wei, Liu Hui, Zhong Shan, Sun Yong-Hua", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2" } ], "reference": [ { "type": "PubMed", "id": "36317480", "url": "https://glygen.org/publication/PubMed/36317480" } ] } ], "pathway": [ { "id": "dre:100333064", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100333064", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I5ZK76-1", "protein_name": "Complex III subunit 9", "gene_name": "Uqcr10-ps1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASPTVASRLYSLLFHRTSTFALTIAVSSLFFERAFDQGADAIYDHSKEGKLWKHIKHKYENQE", "length": 64 }, "evidence": [ { "id": "HGNC:30863", "url": "https://alliancegenome.org/gene/HGNC:30863#orthology", "database": "AGR" }, { "id": "MGI:1913402", "url": "https://alliancegenome.org/gene/MGI:1913402#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "B2RYX1-1", "protein_name": "Complex III subunit 9", "gene_name": "Uqcr10", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASPTVTSRLYSLLFRRTSTFALTIAVSALFFERAFDQGADAVYDYINEGKLWKHIKHKYEKQE", "length": 64 }, "evidence": [ { "id": "HGNC:30863", "url": "https://alliancegenome.org/gene/HGNC:30863#orthology", "database": "AGR" }, { "id": "MGI:1913402", "url": "https://alliancegenome.org/gene/MGI:1913402#orthology", "database": "AGR" }, { "id": "A0A0G2L2Q2", "url": "https://omabrowser.org/oma/group/A0A0G2L2Q2/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "F1NC51-1", "protein_name": "Complex III subunit 9", "gene_name": "UQCR10", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE", "length": 62 }, "evidence": [ { "id": "A0A0G2L2Q2", "url": "https://omabrowser.org/oma/group/A0A0G2L2Q2/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "G3HP15-1", "protein_name": "Complex III subunit 9", "gene_name": "LOC100774773", "tax_id": 10029, "organism": "Cricetulus griseus", "sequence": { "sequence": "MAPTITARLYSLLFRRTSTFALTVVVGALFFERAFDQGADAIYEHINQGKLWKHIKHNYENKE", "length": 63 }, "evidence": [ { "id": "A0A0G2L2Q2", "url": "https://omabrowser.org/oma/group/A0A0G2L2Q2/", "database": "OMA" } ], "glygen_name": "Hamster", "common_name": "Chinese hamster" }, { "uniprot_canonical_ac": "P00130-1", "protein_name": "Cytochrome b-c1 complex subunit 9", "gene_name": "UQCR10", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MVAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE", "length": 64 }, "evidence": [ { "id": "A0A0G2L2Q2", "url": "https://omabrowser.org/oma/group/A0A0G2L2Q2/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "P22289-1", "protein_name": "Cytochrome b-c1 complex subunit 9, mitochondrial", "gene_name": "QCR9", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGDGDDDDE", "length": 66 }, "evidence": [ { "id": "HGNC:30863", "url": "https://alliancegenome.org/gene/HGNC:30863#orthology", "database": "AGR" }, { "id": "MGI:1913402", "url": "https://alliancegenome.org/gene/MGI:1913402#orthology", "database": "AGR" } ], "glygen_name": "Yeast", "common_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2EN79-1", "protein_name": "Complex III subunit 9", "gene_name": "UQCR10", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAAPTLTARLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINQGKLWKHIKHKYENKE", "length": 64 }, "evidence": [ { "id": "A0A0G2L2Q2", "url": "https://omabrowser.org/oma/group/A0A0G2L2Q2/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q8R1I1-1", "protein_name": "Cytochrome b-c1 complex subunit 9", "gene_name": "Uqcr10", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE", "length": 64 }, "evidence": [ { "id": "ZFIN:ZDB-GENE-170406-3", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-170406-3#orthology", "database": "AGR" }, { "id": "HGNC:30863", "url": "https://alliancegenome.org/gene/HGNC:30863#orthology", "database": "AGR" }, { "id": "MGI:1913402", "url": "https://alliancegenome.org/gene/MGI:1913402#orthology", "database": "AGR" }, { "id": "A0A0G2L2Q2", "url": "https://omabrowser.org/oma/group/A0A0G2L2Q2/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UDW1-1", "protein_name": "Cytochrome b-c1 complex subunit 9", "gene_name": "UQCR10", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK", "length": 63 }, "evidence": [ { "id": "ZFIN:ZDB-GENE-170406-3", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-170406-3#orthology", "database": "AGR" }, { "id": "HGNC:30863", "url": "https://alliancegenome.org/gene/HGNC:30863#orthology", "database": "AGR" }, { "id": "MGI:1913402", "url": "https://alliancegenome.org/gene/MGI:1913402#orthology", "database": "AGR" }, { "id": "A0A0G2L2Q2", "url": "https://omabrowser.org/oma/group/A0A0G2L2Q2/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9XY35-1", "protein_name": "Cytochrome b-c1 complex subunit 9", "gene_name": "ox", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MKVIYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDIKGKYE", "length": 55 }, "evidence": [ { "id": "HGNC:30863", "url": "https://alliancegenome.org/gene/HGNC:30863#orthology", "database": "AGR" }, { "id": "MGI:1913402", "url": "https://alliancegenome.org/gene/MGI:1913402#orthology", "database": "AGR" }, { "id": "A0A0G2L2Q2", "url": "https://omabrowser.org/oma/group/A0A0G2L2Q2/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2" } ], "pmid": "" }, { "name": "respiratory chain complex III", "id": "GO:0045275", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045275", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "mitochondrial electron transport, ubiquinol to cytochrome c", "id": "GO:0006122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006122", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2L2Q2", "url": "https://www.uniprot.org/uniprotkb/A0A0G2L2Q2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }