{ "uniprot_canonical_ac": "A0A0G2KLU8-1", "uniprot_ac": "A0A0G2KLU8", "uniprot_id": "A0A0G2KLU8_DANRE", "mass": { "chemical_mass": 33091.0, "monoisotopic_mass": 33091.0 }, "refseq": { "ac": "XP_002665132", "name": "mitochondrial basic amino acids transporter", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002665132" }, "gene_names": [ { "name": "slc25a29", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8", "id": "A0A0G2KLU8" }, { "name": "LOC100329459", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8", "id": "A0A0G2KLU8" }, { "name": "slc25a29l", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002665132", "id": "XP_002665132" }, { "name": "zgc:114094", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8", "id": "A0A0G2KLU8" } ], "protein_names": [ { "name": "Mitochondrial basic amino acids transporter", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8/entry#names_and_taxonomy", "id": "A0A0G2KLU8" }, { "name": "Carnitine/acylcarnitine translocase-like", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8/entry#names_and_taxonomy", "id": "A0A0G2KLU8" }, { "name": "Mitochondrial carnitine/acylcarnitine carrier protein CACL", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8/entry#names_and_taxonomy", "id": "A0A0G2KLU8" }, { "name": "Mitochondrial ornithine transporter 3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8/entry#names_and_taxonomy", "id": "A0A0G2KLU8" }, { "name": "Solute carrier family 25 member 29", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8/entry#names_and_taxonomy", "id": "A0A0G2KLU8" }, { "name": "mitochondrial basic amino acids transporter", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002665132", "id": "XP_002665132" } ], "function": [ { "annotation": "##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_049306965.1-RS_2025_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/11/2025 ##Genome-Annotation-Data-END## MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_133192) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Mar 23, 2011 this sequence version replaced XP_002665132.1. COMPLETENESS: full length.", "evidence": [ { "database": "RefSeq", "id": "XP_002665132", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002665132" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KLU8", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "gene": [ { "name": "slc25a29", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8", "locus": {} } ], "crossref": [ { "id": "ENSDARG00000098849", "url": "https://bgee.org/?page=gene&gene_id=ENSDARG00000098849", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "569608", "url": "https://www.ncbi.nlm.nih.gov/gene/569608", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002067", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002067", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018108", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018108", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023395", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023395", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050567", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050567", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dre:100329459", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100329459", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WSSAVMG", "url": "https://omabrowser.org/oma/group/WSSAVMG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0G2KLU8", "url": "https://www.orthodb.org/?gene=A0A0G2KLU8", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45624", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45624", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45624:SF61", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45624:SF61", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00153", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00153", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_002665132", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002665132", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "32143", "url": "https://www.rhea-db.org/rhea/32143", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "34991", "url": "https://www.rhea-db.org/rhea/34991", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "70827", "url": "https://www.rhea-db.org/rhea/70827", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "70935", "url": "https://www.rhea-db.org/rhea/70935", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71063", "url": "https://www.rhea-db.org/rhea/71063", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71199", "url": "https://www.rhea-db.org/rhea/71199", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "72799", "url": "https://www.rhea-db.org/rhea/72799", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "72803", "url": "https://www.rhea-db.org/rhea/72803", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "72807", "url": "https://www.rhea-db.org/rhea/72807", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2KLU8", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2KLU8-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AB32TAT4", "url": "https://www.uniprot.org/uniprotkb/A0AB32TAT4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AB32TAT4-1", "url": "https://www.uniprot.org/uniprotkb/A0AB32TAT4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALDFAAGCFGGAAGVLVGHPFDTVKVRLQVQSVDKPLYRGTIHCFQSIIRQESMLGLYKGIGSPLMGLTFINAIVFGVQGNAMRMLGSDTPLHQFMAGAAAGLIQSVICCPMELAKTRMQMQGTGEKSLSRRLYRNSLDCLIRIYRRQGFRGINRGMVSTVIRETPGFGIYFLTYDTLTRSLGCEAGDRFIVLKLLLAGGASGIASWISTYPVDVIKSRLQADGVGGDCRYSGMLDCFAQSWQREGWRAFTRGLTSTLLRAFPVNATTFATVTLFLMYMRQEEVEDACESIRPDLQHSSL", "length": 301, "header": "tr|A0A0G2KLU8-1|A0A0G2KLU8_DANRE Isoform 1 of Mitochondrial basic amino acids transporter OS=Danio rerio OX=7955 GN=slc25a29 PE=3 SV=2 CANONICAL=A0A0G2KLU8-1" }, "isoforms": [ { "isoform_ac": "A0A0G2KLU8-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8/entry#A0A0G2KLU8-1", "sequence": { "sequence": "MALDFAAGCFGGAAGVLVGHPFDTVKVRLQVQSVDKPLYRGTIHCFQSIIRQESMLGLYKGIGSPLMGLTFINAIVFGVQGNAMRMLGSDTPLHQFMAGAAAGLIQSVICCPMELAKTRMQMQGTGEKSLSRRLYRNSLDCLIRIYRRQGFRGINRGMVSTVIRETPGFGIYFLTYDTLTRSLGCEAGDRFIVLKLLLAGGASGIASWISTYPVDVIKSRLQADGVGGDCRYSGMLDCFAQSWQREGWRAFTRGLTSTLLRAFPVNATTFATVTLFLMYMRQEEVEDACESIRPDLQHSSL", "length": 301, "header": "tr|A0A0G2KLU8-1|A0A0G2KLU8_DANRE Isoform 1 of Mitochondrial basic amino acids transporter OS=Danio rerio OX=7955 GN=slc25a29 PE=3 SV=2 CANONICAL=A0A0G2KLU8-1" }, "locus": {} }, { "isoform_ac": "A0AB32TAT4-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8/entry#A0AB32TAT4-1", "sequence": { "sequence": "MLTGNARKQLMPRLLKKTPRPSVRVVTVRQCRSPRYLLCPRTPSICRRALITSIGVPTAQPDIPATPPDSSTTVHSDTSRHDHISSKLSGAAGVLVGHPFDTVKVRLQVQSVDKPLYRGTFHCFQSIIRQESVLGLYKGIGSPMMGLTFINAIVFGVQGNAMRRLGEDTPLNQFLAGAAAGSIQCVICCPMELAKTRMQMQGTGEKKSSSRKVYKNSLDCLARIYQREGLRGVNRGMVTTLIRETPGFGVYFLAYDLLTRSLGCEPDDPYMIPKLLFAGGMSGIASWLSTYPVDVIKSRLQADGVGGKYQYSSIMDCTRKSIQREGFRVFTRGLTSTLLRAFPVNAATFATVTLFLLYVRPDEGSKDCEAAHHATLQQQAQPSSL", "length": 385, "header": "tr|A0AB32TAT4-1|A0AB32TAT4_DANRE Computationally mapped isoform of Mitochondrial basic amino acids transporter OS=Danio rerio OX=7955 GN=slc25a29 PE=3 SV=1 CANONICAL=A0A0G2KLU8-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The zebrafish reference genome sequence and its relationship to the human genome.", "journal": "Nature", "date": "2013", "authors": "Howe Kerstin, Clark Matthew D, Torroja Carlos F, Torrance James, Berthelot Camille, Muffato Matthieu, Collins John E, Humphray Sean, McLaren Karen, Matthews Lucy, McLaren Stuart, Sealy Ian, Caccamo Mario, Churcher Carol, Scott Carol, Barrett Jeffrey C, Koch Romke, Rauch Gerd-J\u00f6rg, White Simon, Chow William, Kilian Britt, Quintais Leonor T, Guerra-Assun\u00e7\u00e3o Jos\u00e9 A, Zhou Yi, Gu Yong, Yen Jennifer, Vogel Jan-Hinnerk, Eyre Tina, Redmond Seth, Banerjee Ruby, Chi Jianxiang, Fu Beiyuan, Langley Elizabeth, Maguire Sean F, Laird Gavin K, Lloyd David, Kenyon Emma, Donaldson Sarah, Sehra Harminder, Almeida-King Jeff, Loveland Jane, Trevanion Stephen, Jones Matt, Quail Mike, Willey Dave, Hunt Adrienne, Burton John, Sims Sarah, McLay Kirsten, Plumb Bob, Davis Joy, Clee Chris, Oliver Karen, Clark Richard, Riddle Clare, Elliot David, Eliott David, Threadgold Glen, Harden Glenn, Ware Darren, Begum Sharmin, Mortimore Beverley, Mortimer Beverly, Kerry Giselle, Heath Paul, Phillimore Benjamin, Tracey Alan, Corby Nicole, Dunn Matthew, Johnson Christopher, Wood Jonathan, Clark Susan, Pelan Sarah, Griffiths Guy, Smith Michelle, Glithero Rebecca, Howden Philip, Barker Nicholas, Lloyd Christine, Stevens Christopher, Harley Joanna, Holt Karen, Panagiotidis Georgios, Lovell Jamieson, Beasley Helen, Henderson Carl, Gordon Daria, Auger Katherine, Wright Deborah, Collins Joanna, Raisen Claire, Dyer Lauren, Leung Kenric, Robertson Lauren, Ambridge Kirsty, Leongamornlert Daniel, McGuire Sarah, Gilderthorp Ruth, Griffiths Coline, Manthravadi Deepa, Nichol Sarah, Barker Gary, Whitehead Siobhan, Kay Michael, Brown Jacqueline, Murnane Clare, Gray Emma, Humphries Matthew, Sycamore Neil, Barker Darren, Saunders David, Wallis Justene, Babbage Anne, Hammond Sian, Mashreghi-Mohammadi Maryam, Barr Lucy, Martin Sancha, Wray Paul, Ellington Andrew, Matthews Nicholas, Ellwood Matthew, Woodmansey Rebecca, Clark Graham, Cooper James D, Cooper James, Tromans Anthony, Grafham Darren, Skuce Carl, Pandian Richard, Andrews Robert, Harrison Elliot, Kimberley Andrew, Garnett Jane, Fosker Nigel, Hall Rebekah, Garner Patrick, Kelly Daniel, Bird Christine, Palmer Sophie, Gehring Ines, Berger Andrea, Dooley Christopher M, Ersan-\u00dcr\u00fcn Z\u00fcbeyde, Eser Cigdem, Geiger Horst, Geisler Maria, Karotki Lena, Kirn Anette, Konantz Judith, Konantz Martina, Oberl\u00e4nder Martina, Rudolph-Geiger Silke, Teucke Mathias, Lanz Christa, Raddatz G\u00fcnter, Osoegawa Kazutoyo, Zhu Baoli, Rapp Amanda, Widaa Sara, Langford Cordelia, Yang Fengtang, Schuster Stephan C, Carter Nigel P, Harrow Jennifer, Ning Zemin, Herrero Javier, Searle Steve M J, Enright Anton, Geisler Robert, Plasterk Ronald H A, Lee Charles, Westerfield Monte, de Jong Pieter J, Zon Leonard I, Postlethwait John H, N\u00fcsslein-Volhard Christiane, Hubbard Tim J P, Roest Crollius Hugues, Rogers Jane, Stemple Derek L", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KLU8", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8" } ], "reference": [ { "type": "PubMed", "id": "23594743", "url": "https://glygen.org/publication/PubMed/23594743" } ] } ], "pathway": [ { "id": "dre:100329459", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dre:100329459", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KLU8", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KLU8", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "transmembrane transport", "id": "GO:0055085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KLU8", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8" } ], "pmid": "" }, { "name": "mitochondrial L-ornithine transmembrane transport", "id": "GO:1990575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990575", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KLU8", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "high-affinity L-arginine transmembrane transporter activity", "id": "GO:0005289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005289", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KLU8", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8" } ], "pmid": "" }, { "name": "high-affinity lysine transmembrane transporter activity", "id": "GO:0005292", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005292", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KLU8", "url": "https://www.uniprot.org/uniprotkb/A0A0G2KLU8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 266, "end_pos": 268, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "32143", "name": "", "equation": "L-arginine(in) = L-arginine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "32143", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/32143" } ] }, { "id": "34991", "name": "", "equation": "L-ornithine(in) + L-arginine(out) = L-ornithine(out) + L-arginine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "34991", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/34991" } ] }, { "id": "70827", "name": "", "equation": "L-lysine(out) + L-arginine(in) = L-lysine(in) + L-arginine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "70827", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70827" } ] }, { "id": "70935", "name": "", "equation": "L-lysine(in) = L-lysine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "70935", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70935" } ] }, { "id": "71063", "name": "", "equation": "L-histidine(out) + L-arginine(in) = L-histidine(in) + L-arginine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71063", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71063" } ] }, { "id": "71199", "name": "", "equation": "L-ornithine(in) = L-ornithine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71199", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71199" } ] }, { "id": "72799", "name": "", "equation": "L-homoarginine(in) + L-arginine(out) = L-homoarginine(out) + L-arginine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "72799", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/72799" } ] }, { "id": "72803", "name": "", "equation": "N(omega)-methyl-L-arginine(in) + L-arginine(out) = N(omega)-methyl-L-arginine(out) + L-arginine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "72803", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/72803" } ] }, { "id": "72807", "name": "", "equation": "L-histidine(out) = L-histidine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "72807", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/72807" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 266, "end_pos": 268 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }