{ "uniprot_canonical_ac": "A0A0G2K656-1", "uniprot_ac": "A0A0G2K656", "uniprot_id": "A0A0G2K656_RAT", "mass": { "chemical_mass": 7636.0, "monoisotopic_mass": 7636.0 }, "refseq": {}, "gene_names": [ { "name": "Rpp21", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656", "id": "A0A0G2K656" } ], "protein_names": [ { "name": "Ribonuclease P/MRP subunit p21", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656/entry#names_and_taxonomy", "id": "A0A0G2K656" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K656", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Rpp21", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656", "locus": { "chromosome": "20", "start_pos": 2020106, "end_pos": 2018147, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000000786", "url": "https://www.ensembl.org/id/ENSRNOG00000000786" } ] } } ], "crossref": [ { "id": "RGD:1303090", "url": "https://alliancegenome.org/gene/RGD:1303090", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A0G2K656", "url": "https://alphafold.ebi.ac.uk/entry/A0A0G2K656", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000000786", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000000786", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "AHCILDP", "url": "https://omabrowser.org/oma/group/AHCILDP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1303090", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1303090", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K656", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K656-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGQVKDREAFQRLNFLYQGPLCEEDALSRLLLSPHPWPHLHAAPETPKGTTLDSTDLSDMPAKPAVPQ", "length": 69, "header": "tr|A0A0G2K656-1|A0A0G2K656_RAT Isoform 1 of Ribonuclease P/MRP subunit p21 OS=Rattus norvegicus OX=10116 GN=Rpp21 PE=4 SV=1 CANONICAL=A0A0G2K656-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K656-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656/entry#A0A0G2K656-1", "sequence": { "sequence": "MAGQVKDREAFQRLNFLYQGPLCEEDALSRLLLSPHPWPHLHAAPETPKGTTLDSTDLSDMPAKPAVPQ", "length": 69, "header": "tr|A0A0G2K656-1|A0A0G2K656_RAT Isoform 1 of Ribonuclease P/MRP subunit p21 OS=Rattus norvegicus OX=10116 GN=Rpp21 PE=4 SV=1 CANONICAL=A0A0G2K656-1" }, "locus": { "chromosome": "20", "start_pos": 2019767, "end_pos": 2018177, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000001024.6", "url": "https://www.ensembl.org/id/ENSRNOT00000001024.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000001024.3", "url": "https://www.ensembl.org/id/ENSRNOP00000001024.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "P40571-1", "protein_name": "Ribonuclease P protein subunit RPR2", "gene_name": "RPR2", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MGKKAHGGKMKPEIDENGTLLVPPPRTIANQDHFHRLNYLYQISAYQTRARQKARTDAHTPLARNYIKSMDLISKKTKTSLLPTIKRTICKKCHRLLWTPKKLEITSDGALSVMCGCGTVKRFNIGADPNYRTYSEREGNLLNS", "length": 144 }, "evidence": [ { "id": "HGNC:21300", "url": "https://alliancegenome.org/gene/HGNC:21300#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-040801-37", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040801-37#orthology", "database": "AGR" }, { "id": "MGI:1914926", "url": "https://alliancegenome.org/gene/MGI:1914926#orthology", "database": "AGR" } ], "glygen_name": "Yeast", "common_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q6DBZ7-1", "protein_name": "Ribonuclease P 21 subunit", "gene_name": "rpp21", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MAGNIKDKEAFQRLNFLYQAAHCVLAQNPENIELARFYCFTQKTISKRLVLRQDPSVKRTICKKCYTLLIPGVTSTVRQKRGKGRQRKTVVRCLSCGLTKRFPNNPKHKLWVDQPEAQLENQTSQGAGPSSNSTTQGKKCDGSSGSASTAAKTTPTAQTNKPKSS", "length": 165 }, "evidence": [ { "id": "HGNC:21300", "url": "https://alliancegenome.org/gene/HGNC:21300#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-040801-37", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040801-37#orthology", "database": "AGR" }, { "id": "MGI:1914926", "url": "https://alliancegenome.org/gene/MGI:1914926#orthology", "database": "AGR" }, { "id": "RGD:1303090", "url": "https://alliancegenome.org/gene/RGD:1303090#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q86B65-1", "protein_name": "Ribonuclease P/MRP subunit p21, isoform A", "gene_name": "Rpp21", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSRDNKMKHLTQRAISSRMNYLFQASNLMAVGNQPKLAAYYGKLCRNVGTKAIMHMAPAVKRSLCRRCFLPLIPGVNTELHVEEGAQEAKTDAQAQSNGAVKTKKKRHRRQRKKPRSRKTGNTNQEESEEQIQESTEQVSFFLECSLCCGRRSFAANSQRDCWLEQPQSIVQVVSLPKEKDER", "length": 183 }, "evidence": [ { "id": "HGNC:21300", "url": "https://alliancegenome.org/gene/HGNC:21300#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-040801-37", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040801-37#orthology", "database": "AGR" }, { "id": "MGI:1914926", "url": "https://alliancegenome.org/gene/MGI:1914926#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8R040-1", "protein_name": "Ribonuclease P protein subunit p21", "gene_name": "Rpp21", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAGPVKDREAFQRLSFLYQAAHCVLSQNPENQALARFYCHTEKTIAKRLVLRQDPSVKRTLCRSCSSLLIPGLTCTQRQRRRKGQRWTVQTCLTCQRSQRFLNDPKHLLWGDRPEAQLENQADINPSEPLPNIADLPKENIQTQALNTSE", "length": 150 }, "evidence": [ { "id": "HGNC:21300", "url": "https://alliancegenome.org/gene/HGNC:21300#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-040801-37", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040801-37#orthology", "database": "AGR" }, { "id": "MGI:1914926", "url": "https://alliancegenome.org/gene/MGI:1914926#orthology", "database": "AGR" }, { "id": "RGD:1303090", "url": "https://alliancegenome.org/gene/RGD:1303090#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9H633-1", "protein_name": "Ribonuclease P protein subunit p21", "gene_name": "RPP21", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ", "length": 154 }, "evidence": [ { "id": "HGNC:21300", "url": "https://alliancegenome.org/gene/HGNC:21300#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-040801-37", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-040801-37#orthology", "database": "AGR" }, { "id": "MGI:1914926", "url": "https://alliancegenome.org/gene/MGI:1914926#orthology", "database": "AGR" }, { "id": "RGD:1303090", "url": "https://alliancegenome.org/gene/RGD:1303090#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "multimeric ribonuclease P complex", "id": "GO:0030681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030681", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K656", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K656", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656" } ], "pmid": "" }, { "name": "tRNA 5'-leader removal", "id": "GO:0001682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001682", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K656", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "ribonuclease P RNA binding", "id": "GO:0033204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033204", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K656", "url": "https://www.uniprot.org/uniprotkb/A0A0G2K656" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0G2K656-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 69, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0G2K656-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A0G2K656" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }