{ "uniprot_canonical_ac": "A0A0A0MP93-1", "uniprot_ac": "A0A0A0MP93", "uniprot_id": "A0A0A0MP93_BOVIN", "mass": { "chemical_mass": 14096.0, "monoisotopic_mass": 14096.0 }, "refseq": { "ac": "XP_002694650", "name": "histone H2A type 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002694650" }, "gene_names": [ { "name": "LOC614881", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93", "id": "A0A0A0MP93" }, { "name": "LOC614881", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002694650", "id": "XP_002694650" } ], "protein_names": [ { "name": "Histone H2A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93/entry#names_and_taxonomy", "id": "A0A0A0MP93" }, { "name": "histone H2A type 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002694650", "id": "XP_002694650" } ], "function": [ { "annotation": "Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.", "evidence": [ { "database": "UniProtKB", "id": "A0A0A0MP93", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93#function" }, { "database": "UniProtKB", "id": "ARBA00002001", "url": "https://www.uniprot.org/uniprotkb/ARBA00002001#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0A0A0MP93", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC614881", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93", "locus": {} } ], "crossref": [ { "id": "A0A0A0MP93", "url": "https://alphafold.ebi.ac.uk/entry/A0A0A0MP93", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSBTAG00000031468", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000031468", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00074", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00074", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "614881", "url": "https://www.ncbi.nlm.nih.gov/gene/614881", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002119", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002119", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007125", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007125", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032454", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032454", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032458", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032458", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "A0A0A0MP93", "url": "https://www.orthodb.org/?gene=A0A0A0MP93", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23430", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23430", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00125", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00125", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16211", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF16211", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-BTA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-3214815", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-BTA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-3214847", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-BTA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-3214858", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-BTA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5689603", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-BTA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-BTA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5689901", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_002694650", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002694650", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0A0MP93", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A0MP93-1", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLHKGNYTERVGAGAPVYLAAVLEYLTAEILELAGNAARNNKKTRIIPRHLQLAIHNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK", "length": 130, "header": "tr|A0A0A0MP93-1|A0A0A0MP93_BOVIN Isoform 1 of Histone H2A OS=Bos taurus OX=9913 GN=LOC614881 PE=3 SV=2 CANONICAL=A0A0A0MP93-1" }, "isoforms": [ { "isoform_ac": "A0A0A0MP93-1", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93/entry#A0A0A0MP93-1", "sequence": { "sequence": "MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLHKGNYTERVGAGAPVYLAAVLEYLTAEILELAGNAARNNKKTRIIPRHLQLAIHNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK", "length": 130, "header": "tr|A0A0A0MP93-1|A0A0A0MP93_BOVIN Isoform 1 of Histone H2A OS=Bos taurus OX=9913 GN=LOC614881 PE=3 SV=2 CANONICAL=A0A0A0MP93-1" }, "locus": { "chromosome": "17", "start_pos": 66340980, "end_pos": 66340591, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000011811.7", "url": "https://www.ensembl.org/id/ENSBTAT00000011811.7" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000011811.6", "url": "https://www.ensembl.org/id/ENSBTAP00000011811.6" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-BTA-3214815", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-3214815", "resource": "Reactome", "description": "HDACs deacetylate histones" }, { "id": "R-BTA-3214847", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-3214847", "resource": "Reactome", "description": "HATs acetylate histones" }, { "id": "R-BTA-3214858", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-3214858", "resource": "Reactome", "description": "RMTs methylate histone arginines" }, { "id": "R-BTA-5689603", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5689603", "resource": "Reactome", "description": "UCH proteinases" }, { "id": "R-BTA-5689880", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-BTA-5689901", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5689901", "resource": "Reactome", "description": "Metalloprotease DUBs" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0A0A0MP93", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "A0A0A0MP93", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93" } ], "pmid": "" }, { "name": "structural constituent of chromatin", "id": "GO:0030527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527", "evidence": [ { "database": "UniProtKB", "id": "A0A0A0MP93", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0A0MP93", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93" } ], "pmid": "" }, { "name": "nucleosome", "id": "GO:0000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786", "evidence": [ { "database": "UniProtKB", "id": "A0A0A0MP93", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "heterochromatin formation", "id": "GO:0031507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031507", "evidence": [ { "database": "UniProtKB", "id": "A0A0A0MP93", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MP93" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 39, "end_pos": 41, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0A0MP93-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 130, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0A0MP93-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A0A0MP93" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 39, "end_pos": 41 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }