{ "uniprot_canonical_ac": "A0A087WSY4-1", "uniprot_ac": "A0A087WSY4", "uniprot_id": "HV432_HUMAN", "mass": { "chemical_mass": 13025.0, "monoisotopic_mass": 13025.0 }, "refseq": {}, "gene_names": [ { "name": "IGHV4-30-2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4", "id": "A0A087WSY4" } ], "protein_names": [ { "name": "Immunoglobulin heavy variable 4-30-2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4/entry#names_and_taxonomy", "id": "A0A087WSY4" } ], "function": [ { "annotation": "V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268).", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4#function" }, { "database": "PubMed", "id": "20176268", "url": "https://glygen.org/publication/PubMed/20176268" }, { "database": "PubMed", "id": "22158414", "url": "https://glygen.org/publication/PubMed/22158414" }, { "database": "PubMed", "id": "17576170", "url": "https://glygen.org/publication/PubMed/17576170" }, { "database": "PubMed", "id": "24600447", "url": "https://glygen.org/publication/PubMed/24600447" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "gene": [ { "name": "IGHV4-30-2", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4", "locus": {} } ], "crossref": [ { "id": "HGNC:5647", "url": "https://alliancegenome.org/gene/HGNC:5647", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A087WSY4", "url": "https://alphafold.ebi.ac.uk/entry/A0A087WSY4", "database": "AlphaFoldDB", "categories": [] }, { "id": "IGHV4-30-2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IGHV4-30-2", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "5647", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:5647", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "1406268", "url": "https://www.iedb.org/epitope/1406268", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2265561", "url": "https://www.iedb.org/epitope/2265561", "database": "IEDB", "categories": [ "Other" ] }, { "id": "427706", "url": "https://www.iedb.org/epitope/427706", "database": "IEDB", "categories": [ "Other" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050199", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050199", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "WARYTVK", "url": "https://omabrowser.org/oma/group/WARYTVK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A087WSY4", "url": "https://www.orthodb.org/?gene=A0A087WSY4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23266", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23266", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A087WSY4", "url": "https://pharos.nih.gov/targets/A0A087WSY4", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A0A087WSY4", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:PR_A0A087WSY4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WSY4-1", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR", "length": 118, "header": "sp|A0A087WSY4-1|HV432_HUMAN Isoform 1 of Immunoglobulin heavy variable 4-30-2 OS=Homo sapiens OX=9606 GN=IGHV4-30-2 PE=1 SV=1 CANONICAL=A0A087WSY4-1" }, "isoforms": [ { "isoform_ac": "A0A087WSY4-1", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4/entry#A0A087WSY4-1", "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR", "length": 118, "header": "sp|A0A087WSY4-1|HV432_HUMAN Isoform 1 of Immunoglobulin heavy variable 4-30-2 OS=Homo sapiens OX=9606 GN=IGHV4-30-2 PE=1 SV=1 CANONICAL=A0A087WSY4-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Nomenclature of the human immunoglobulin heavy (IGH) genes.", "journal": "Exp. Clin. Immunogenet.", "date": "2001", "authors": "Lefranc M P", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "reference": [ { "type": "PubMed", "id": "11340299", "url": "https://glygen.org/publication/PubMed/11340299" } ] }, { "title": "Immunoglobulin somatic hypermutation.", "journal": "Annual review of genetics", "date": "2007", "authors": "Teng Grace, Papavasiliou F Nina", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "reference": [ { "type": "PubMed", "id": "17576170", "url": "https://glygen.org/publication/PubMed/17576170" } ] }, { "title": "Structure and function of immunoglobulins.", "journal": "The Journal of allergy and clinical immunology", "date": "2010-02", "authors": "Schroeder Harry W, Cavacini Lisa", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "reference": [ { "type": "PubMed", "id": "20176268", "url": "https://glygen.org/publication/PubMed/20176268" } ] }, { "title": "Molecular programming of B cell memory.", "journal": "Nature reviews. Immunology", "date": "2011-12-09", "authors": "McHeyzer-Williams Michael, Okitsu Shinji, Wang Nathaniel, McHeyzer-Williams Louise", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "reference": [ { "type": "PubMed", "id": "22158414", "url": "https://glygen.org/publication/PubMed/22158414" } ] }, { "title": "Immunoglobulin and T Cell Receptor Genes: IMGT(\u00ae) and the Birth and Rise of Immunoinformatics.", "journal": "Frontiers in immunology", "date": "2014", "authors": "Lefranc Marie-Paule", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "reference": [ { "type": "PubMed", "id": "24600447", "url": "https://glygen.org/publication/PubMed/24600447" } ] }, { "title": "Targeting B-cell malignancies through human B-cell receptor specific CD4+ T cells.", "journal": "Oncoimmunology", "date": "2016", "authors": "Weng Jinsheng, Baio Flavio Egidio, Moriarty Kelsey E, Torikai Hiroki, Wang Hua, Liu Zhiqiang, Maiti Sourindra N, Gwak Dongho, Popescu Michael S, Cha Soung-Chul, Cooper Laurence J N, Neelapu Sattva S, Kwak Larry W", "evidence": [ { "database": "IEDB", "id": "2265561", "url": "https://www.iedb.org/epitope/2265561" } ], "reference": [ { "type": "PubMed", "id": "27999743", "url": "https://glygen.org/publication/PubMed/27999743" } ] }, { "title": "ERAP2 Increases the Abundance of a Peptide Submotif Highly Selective for the Birdshot Uveitis-Associated HLA-A29.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Venema Wouter J, Hiddingh Sanne, de Boer Joke H, Claas Frans H J, Mulder Arend, den Hollander Anneke I, Stratikos Efstratios, Sarkizova Siranush, van der Veken Lars T, Janssen George M C, van Veelen Peter A, Kuiper Jonas J W", "evidence": [ { "database": "IEDB", "id": "1406268", "url": "https://www.iedb.org/epitope/1406268" } ], "reference": [ { "type": "PubMed", "id": "33717175", "url": "https://glygen.org/publication/PubMed/33717175" } ] }, { "title": "Retina-arrestin specific CD8+ T cells are not implicated in HLA-A29-positive birdshot chorioretinitis.", "journal": "Clinical immunology (Orlando, Fla.)", "date": "2023-02", "authors": "Venema W J, Hiddingh S, Janssen G M C, Ossewaarde-van Norel J, van Loon N Dam, de Boer J H, van Veelen P A, Kuiper J J W", "evidence": [ { "database": "IEDB", "id": "427706", "url": "https://www.iedb.org/epitope/427706" } ], "reference": [ { "type": "PubMed", "id": "36581221", "url": "https://glygen.org/publication/PubMed/36581221" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A075B5S6-1", "protein_name": "Immunoglobulin heavy variable 3-1", "gene_name": "Ighv3-1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSVLILLWLFTAFPGILSDVQLQESGPGMVKPSQSLSLTCTVTGYSITSGYDWHWIRHFPGNKLEWMGYISYSGSTNYNPSLKSRISITHDTSKNHFFLKLNSVTTEDTATYYCAR", "length": 116 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "HGNC:5647", "url": "https://alliancegenome.org/gene/HGNC:5647#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B6R2-1", "protein_name": "Immunoglobulin heavy variable 4-4", "gene_name": "IGHV4-4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR", "length": 117 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "A0A075B7B6-1", "protein_name": "Immunoglobulin heavy variable 4/OR15-8 (non-functional)", "gene_name": "IGHV4OR15-8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADRAVYYCAR", "length": 117 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "A0A0A6YXF1-1", "protein_name": "Immunoglobulin heavy variable V3-4", "gene_name": "Ighv3-4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRVLILVYLLTALPGILSDVQLQESGPALVKPSQTVSLTCTVTGYSITNGNHWWNWIRQVSGSKLEWIGYISSSGSTDSNPSLKSRISITRDTSKNQLFLQLNSVTTEDIATYYCAR", "length": 117 }, "evidence": [ { "id": "HGNC:5647", "url": "https://alliancegenome.org/gene/HGNC:5647#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A0B4J1U7-1", "protein_name": "Immunoglobulin heavy variable 6-1", "gene_name": "IGHV6-1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSVSFLIFLPVLGLPWGVLSQVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR", "length": 121 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH34-1", "protein_name": "Immunoglobulin heavy variable 4-28", "gene_name": "IGHV4-28", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR", "length": 117 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH41-1", "protein_name": "Immunoglobulin heavy variable 4-61", "gene_name": "IGHV4-61", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSVSSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR", "length": 118 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "D3ZK57-1", "protein_name": "Immunoglobulin heavy chain like 7", "gene_name": "Ighl7", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRMLVLLYLLTALPGILSEVQLQESGPGLVKPSQSLSLTCSVTGYSITSSYRWNWIRKFPGNKLEWMGYINSAGSTNYNPSLKSRISITRDTSKNQFFLQVNSVTTEDTATYYCARHSVESSV", "length": 123 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" }, { "id": "A0A087WSY4", "url": "https://omabrowser.org/oma/group/A0A087WSY4/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDLMCKKMKHLWFFLLLVAAPRWVLSQLQLQESGPGLVKPSETLSLTCTVSGGSISSSSYYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR", "length": 125 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:3648045", "url": "https://alliancegenome.org/gene/MGI:3648045#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR", "length": 116 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDLLHKNMKHLWFFLLLVAAPRWVLSQVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR", "length": 123 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P0DP06-1", "protein_name": "Immunoglobulin heavy variable 4-30-4", "gene_name": "IGHV4-30-4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR", "length": 118 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:3648045", "url": "https://alliancegenome.org/gene/MGI:3648045#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P0DP07-1", "protein_name": "Immunoglobulin heavy variable 4-31", "gene_name": "IGHV4-31", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR", "length": 118 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P0DP08-1", "protein_name": "Immunoglobulin heavy variable 4-38-2", "gene_name": "IGHV4-38-2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR", "length": 117 }, "evidence": [ { "id": "MGI:4439534", "url": "https://alliancegenome.org/gene/MGI:4439534#orthology", "database": "AGR" }, { "id": "MGI:3648045", "url": "https://alliancegenome.org/gene/MGI:3648045#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "MGI:3644034", "url": "https://alliancegenome.org/gene/MGI:3644034#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P18531-1", "protein_name": "Ig heavy chain V region 3-6", "gene_name": "Ighv3-6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKVLSLLYLLTAIPGILSDVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYYCAR", "length": 116 }, "evidence": [ { "id": "HGNC:5647", "url": "https://alliancegenome.org/gene/HGNC:5647#orthology", "database": "AGR" }, { "id": "MGI:4439856", "url": "https://alliancegenome.org/gene/MGI:4439856#orthology", "database": "AGR" }, { "id": "A0A087WSY4", "url": "https://omabrowser.org/oma/group/A0A087WSY4/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P18533-1", "protein_name": "Immunoglobulin heavy variable 3-5", "gene_name": "Ighv3-5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKMFTLLYLLTVVPGILSDVQLQESGPGLVKPSQSIALTCTVTGISITTGNYRWSWIRQFPGNKLEWIGYIYYSAITSYNPSPKSRTTITRDTSKNQFFLEMNSLTAEDTATYYCAR", "length": 117 }, "evidence": [ { "id": "HGNC:5647", "url": "https://alliancegenome.org/gene/HGNC:5647#orthology", "database": "AGR" }, { "id": "MGI:3648045", "url": "https://alliancegenome.org/gene/MGI:3648045#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "pmid": "" }, { "name": "immunoglobulin complex", "id": "GO:0019814", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019814", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "antigen binding", "id": "GO:0003823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003823", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immunoglobulin mediated immune response", "id": "GO:0016064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016064", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSY4", "url": "https://www.uniprot.org/uniprotkb/A0A087WSY4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A087WSY4-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 118, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A087WSY4-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A087WSY4" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }