{ "uniprot_canonical_ac": "A0A087WSG3-1", "uniprot_ac": "A0A087WSG3", "uniprot_id": "A0A087WSG3_MOUSE", "mass": { "chemical_mass": 13857.0, "monoisotopic_mass": 13857.0 }, "refseq": {}, "gene_names": [ { "name": "Gm28269", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A087WSG3", "id": "A0A087WSG3" } ], "protein_names": [ { "name": "Predicted gene 28269", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A087WSG3/entry#names_and_taxonomy", "id": "A0A087WSG3" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A087WSG3", "url": "https://www.uniprot.org/uniprotkb/A0A087WSG3" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Gm28269", "url": "https://www.uniprot.org/uniprotkb/A0A087WSG3", "locus": { "chromosome": "X", "start_pos": 21609679, "end_pos": 21611336, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000101818", "url": "https://www.ensembl.org/id/ENSMUSG00000101818" } ] } } ], "crossref": [ { "id": "MGI:5578975", "url": "https://alliancegenome.org/gene/MGI:5578975", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A087WSG3", "url": "https://alphafold.ebi.ac.uk/entry/A0A087WSG3", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000101818", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000101818", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "5578975", "url": "http://www.informatics.jax.org/marker/MGI:5578975", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "SMRNHIP", "url": "https://omabrowser.org/oma/group/SMRNHIP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A087WSG3", "url": "https://www.orthodb.org/?gene=A0A087WSG3", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "XP_006527778", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006527778", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WSG3", "url": "https://www.uniprot.org/uniprotkb/A0A087WSG3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WSG3-1", "url": "https://www.uniprot.org/uniprotkb/A0A087WSG3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MINVNLILLIVSCSLLILIISLLTLLFQLIMGKKSPKKLYPGGKKVTAIRNHIPFVPLSINRILLASGVRRGPGKKQASVKTNSLNSKVDKLEQFMMIKGLYDCVKIIKKPTRKPDKDSDSDGNN", "length": 125, "header": "tr|A0A087WSG3-1|A0A087WSG3_MOUSE Isoform 1 of Predicted gene 28269 OS=Mus musculus OX=10090 GN=Gm28269 PE=1 SV=1 CANONICAL=A0A087WSG3-1" }, "isoforms": [ { "isoform_ac": "A0A087WSG3-1", "url": "https://www.uniprot.org/uniprotkb/A0A087WSG3/entry#A0A087WSG3-1", "sequence": { "sequence": "MINVNLILLIVSCSLLILIISLLTLLFQLIMGKKSPKKLYPGGKKVTAIRNHIPFVPLSINRILLASGVRRGPGKKQASVKTNSLNSKVDKLEQFMMIKGLYDCVKIIKKPTRKPDKDSDSDGNN", "length": 125, "header": "tr|A0A087WSG3-1|A0A087WSG3_MOUSE Isoform 1 of Predicted gene 28269 OS=Mus musculus OX=10090 GN=Gm28269 PE=1 SV=1 CANONICAL=A0A087WSG3-1" }, "locus": { "chromosome": "X", "start_pos": 21611223, "end_pos": 21609750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000189511.2", "url": "https://www.ensembl.org/id/ENSMUST00000189511.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000141034.2", "url": "https://www.ensembl.org/id/ENSMUSP00000141034.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Modernizing reference genome assemblies.", "journal": "PLoS Biol.", "date": "2011", "authors": "Church Deanna M, Schneider Valerie A, Graves Tina, Auger Katherine, Cunningham Fiona, Bouk Nathan, Chen Hsiu-Chuan, Agarwala Richa, McLaren William M, Ritchie Graham R S, Albracht Derek, Kremitzki Milinn, Rock Susan, Kotkiewicz Holland, Kremitzki Colin, Wollam Aye, Trani Lee, Fulton Lucinda, Fulton Robert, Matthews Lucy, Whitehead Siobhan, Chow Will, Torrance James, Dunn Matthew, Harden Glenn, Threadgold Glen, Wood Jonathan, Collins Joanna, Heath Paul, Griffiths Guy, Pelan Sarah, Grafham Darren, Eichler Evan E, Weinstock George, Mardis Elaine R, Wilson Richard K, Howe Kerstin, Flicek Paul, Hubbard Tim", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSG3", "url": "https://www.uniprot.org/uniprotkb/A0A087WSG3" } ], "reference": [ { "type": "PubMed", "id": "21750661", "url": "https://glygen.org/publication/PubMed/21750661" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6AV06-1", "protein_name": "Uncharacterized protein", "gene_name": "ENSRNOG00000068085", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MININIILFLVGGSLLVIIISLLKLLHQVIMEKRPSKPLYPGGKRVTMSMRNHIPFVPLSINRKLLASGGGIRPVPGKQQASVKMNSFDSKVDRLEQFMLMKGLYDCVKVIKKPTRKPVKDSDSDSNN", "length": 128 }, "evidence": [ { "id": "A0A087WSG3", "url": "https://omabrowser.org/oma/group/A0A087WSG3/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A087WSG3", "url": "https://www.uniprot.org/uniprotkb/A0A087WSG3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A087WSG3-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 125, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A087WSG3-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A087WSG3" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }