{ "uniprot_canonical_ac": "A0A087WQL6-1", "uniprot_ac": "A0A087WQL6", "uniprot_id": "A0A087WQL6_MOUSE", "mass": { "chemical_mass": 6212.0, "monoisotopic_mass": 6212.0 }, "refseq": { "ac": "NP_034804", "name": "keratin-associated protein 20-2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034804" }, "gene_names": [ { "name": "Krtap20-1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6", "id": "A0A087WQL6" }, { "name": "HGTpII.3; Krtap6-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034804", "id": "NP_034804" }, { "name": "Krtap20-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034804", "id": "NP_034804" }, { "name": "Krtap6-3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6", "id": "A0A087WQL6" } ], "protein_names": [ { "name": "Keratin associated protein 20-1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6/entry#names_and_taxonomy", "id": "A0A087WQL6" }, { "name": "keratin-associated protein 20-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034804", "id": "NP_034804" }, { "name": "keratin-associated protein 6.3; keratin associated protein 6-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034804", "id": "NP_034804" } ], "function": [ { "annotation": "Krtap16 is a hair keratin-associated protein gene complex regulated by Hoxc13; localized to chromosome 16", "evidence": [ { "database": "RefSeq", "id": "NP_034804", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034804" }, { "database": "PubMed", "id": "15385554", "url": "https://glygen.org/publication/PubMed/15385554" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A087WQL6", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Krtap20-1", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6", "locus": { "chromosome": "16", "start_pos": 88881422, "end_pos": 88880903, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000057855", "url": "https://www.ensembl.org/id/ENSMUSG00000057855" } ] } } ], "crossref": [ { "id": "MGI:1330279", "url": "https://alliancegenome.org/gene/MGI:1330279", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A087WQL6", "url": "https://alphafold.ebi.ac.uk/entry/A0A087WQL6", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000057855", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000057855", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "100040249", "url": "https://www.ncbi.nlm.nih.gov/gene/100040249", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR021743", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021743", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR052878", "url": "https://www.ebi.ac.uk/interpro/entry/IPR052878", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "1330279", "url": "http://www.informatics.jax.org/marker/MGI:1330279", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CERYSSY", "url": "https://omabrowser.org/oma/group/CERYSSY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR39653", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR39653", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR39653:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR39653:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF11759", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF11759", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6805567", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_034804", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034804", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WQL6", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WQL6-1", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6T6A9", "url": "https://www.uniprot.org/uniprotkb/F6T6A9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6T6A9-1", "url": "https://www.uniprot.org/uniprotkb/F6T6A9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCYYRGYYGGLGYGYGGLGYGYGCGYGCGYGCGYGGYGGYGYGCCRPLCCRRYYGFY", "length": 57, "header": "tr|A0A087WQL6-1|A0A087WQL6_MOUSE Isoform 1 of Keratin associated protein 20-1 OS=Mus musculus OX=10090 GN=Krtap20-1 PE=4 SV=1 CANONICAL=A0A087WQL6-1" }, "isoforms": [ { "isoform_ac": "A0A087WQL6-1", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6/entry#A0A087WQL6-1", "sequence": { "sequence": "MCYYRGYYGGLGYGYGGLGYGYGCGYGCGYGCGYGGYGGYGYGCCRPLCCRRYYGFY", "length": 57, "header": "tr|A0A087WQL6-1|A0A087WQL6_MOUSE Isoform 1 of Keratin associated protein 20-1 OS=Mus musculus OX=10090 GN=Krtap20-1 PE=4 SV=1 CANONICAL=A0A087WQL6-1" }, "locus": { "chromosome": "16", "start_pos": 88881141, "end_pos": 88880971, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000185581.2", "url": "https://www.ensembl.org/id/ENSMUST00000185581.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000140246.2", "url": "https://www.ensembl.org/id/ENSMUSP00000140246.2" } ] } }, { "isoform_ac": "F6T6A9-1", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6/entry#F6T6A9-1", "sequence": { "sequence": "YRGYYGGLGYGYGGLGYGYGCGYGCGYGCGYGGYGGYGYGCCRPLCCRRYYGFY", "length": 54, "header": "tr|F6T6A9-1|A0A087WQL6_MOUSE Computationally mapped isoform of Keratin associated protein 20-1 OS=Mus musculus OX=10090 GN=Krtap20-1 PE=4 SV=1 CANONICAL=A0A087WQL6-1" }, "locus": { "chromosome": "16", "start_pos": 88881141, "end_pos": 88880980, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000079151.2", "url": "https://www.ensembl.org/id/ENSMUST00000079151.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000078152.2", "url": "https://www.ensembl.org/id/ENSMUSP00000078152.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Krtap16, characterization of a new hair keratin-associated protein (KAP) gene complex on mouse chromosome 16 and evidence for regulation by Hoxc13.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Pruett ND, Tkatchenko TV, Jave-Suarez L, Jacobs DF, Potter CS, Tkatchenko AV, Schweizer J, Awgulewitsch A", "evidence": [ { "database": "RefSeq", "id": "NP_034804", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034804" } ], "reference": [ { "type": "PubMed", "id": "15385554", "url": "https://glygen.org/publication/PubMed/15385554" } ] }, { "title": "Modernizing reference genome assemblies.", "journal": "PLoS Biol.", "date": "2011", "authors": "Church Deanna M, Schneider Valerie A, Graves Tina, Auger Katherine, Cunningham Fiona, Bouk Nathan, Chen Hsiu-Chuan, Agarwala Richa, McLaren William M, Ritchie Graham R S, Albracht Derek, Kremitzki Milinn, Rock Susan, Kotkiewicz Holland, Kremitzki Colin, Wollam Aye, Trani Lee, Fulton Lucinda, Fulton Robert, Matthews Lucy, Whitehead Siobhan, Chow Will, Torrance James, Dunn Matthew, Harden Glenn, Threadgold Glen, Wood Jonathan, Collins Joanna, Heath Paul, Griffiths Guy, Pelan Sarah, Grafham Darren, Eichler Evan E, Weinstock George, Mardis Elaine R, Wilson Richard K, Howe Kerstin, Flicek Paul, Hubbard Tim", "evidence": [ { "database": "UniProtKB", "id": "F6T6A9", "url": "https://www.uniprot.org/uniprotkb/F6T6A9" } ], "reference": [ { "type": "PubMed", "id": "21750661", "url": "https://glygen.org/publication/PubMed/21750661" } ] } ], "pathway": [ { "id": "R-MMU-6805567", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6805567", "resource": "Reactome", "description": "Keratinization" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A087WPH4-1", "protein_name": "Keratin associated protein 20-23", "gene_name": "krtap20-23", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVTPRLKKPTACLSQTTSGTPDNMCYYGGYYGGLGYGYGGLGYGYGCGYGGYGGYGYGCCRPLCCRRYWSCGFY", "length": 74 }, "evidence": [ { "id": "HGNC:18944", "url": "https://alliancegenome.org/gene/HGNC:18944#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A0G2K4W1-1", "protein_name": "Keratin-associated protein 20-2-like", "gene_name": "LOC102551497", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MCYYGSYYGGLGYGYGGLGCGYGCGYGGYGSYGYGCCRPLCCRRYWSCGFY", "length": 51 }, "evidence": [ { "id": "HGNC:18944", "url": "https://alliancegenome.org/gene/HGNC:18944#orthology", "database": "AGR" }, { "id": "HGNC:18943", "url": "https://alliancegenome.org/gene/HGNC:18943#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "D3YX18-1", "protein_name": "Keratin associated protein 20-22", "gene_name": "Krtap20-22", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCYYRGYYGGLGYGYGGLGCGYGCGYGCGYGGYGYGCCRPLCCGRYWSYGFY", "length": 52 }, "evidence": [ { "id": "HGNC:18943", "url": "https://alliancegenome.org/gene/HGNC:18943#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "D3Z714-1", "protein_name": "Keratin associated protein 20-20", "gene_name": "Krtap20-20", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCYYSGYYGGLGYGYGGLGYGYGYGCGYGCGYGGYGYGCCHPLCCRRYWSCGFY", "length": 54 }, "evidence": [ { "id": "HGNC:18944", "url": "https://alliancegenome.org/gene/HGNC:18944#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "D3ZK91-1", "protein_name": "Keratin-associated protein 20-2-like", "gene_name": "LOC102551406", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MCYYGGYYGGLGYGYGGLGCGYGCGYGCGYGCGYGGYGYGCCRPLCCRRYWSYGFY", "length": 56 }, "evidence": [ { "id": "HGNC:18943", "url": "https://alliancegenome.org/gene/HGNC:18943#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "E9Q0A8-1", "protein_name": "Keratin associated protein 20-2", "gene_name": "Krtap20-2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCYYGSYYGGLGCGYGGLGYGYGCGYGCGYGCGYGCGYGGYGYGCCRPLCYRRYWSCGFY", "length": 60 }, "evidence": [ { "id": "HGNC:18944", "url": "https://alliancegenome.org/gene/HGNC:18944#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "M0R8W2-1", "protein_name": "Keratin-associated protein 20-2-like", "gene_name": "LOC102551771", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MCYYSSYYGGQGYGCGYGYGCGYGCGCSYGGYGCGCGAYGFGCCRPLCCRRYWSYGFY", "length": 58 }, "evidence": [ { "id": "HGNC:18943", "url": "https://alliancegenome.org/gene/HGNC:18943#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q3LI61-1", "protein_name": "Keratin-associated protein 20-2", "gene_name": "KRTAP20-2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MCYYSNYYGGLRYGYGVLGGGYGCGCGYGHGYGGLGCGYGRGYGGYGYGCCRPSCYGRYWSCGFY", "length": 65 }, "evidence": [ { "id": "HGNC:18944", "url": "https://alliancegenome.org/gene/HGNC:18944#orthology", "database": "AGR" }, { "id": "MGI:1330279", "url": "https://alliancegenome.org/gene/MGI:1330279#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q3LI63-1", "protein_name": "Keratin-associated protein 20-1", "gene_name": "KRTAP20-1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MIYYSNYYGGYGYGGLGCGYGCGYRGYGCGYGGYGGYGNGYYCPSCYGRYWSYGFY", "length": 56 }, "evidence": [ { "id": "MGI:1330279", "url": "https://alliancegenome.org/gene/MGI:1330279#orthology", "database": "AGR" }, { "id": "HGNC:18943", "url": "https://alliancegenome.org/gene/HGNC:18943#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q3V4B6-1", "protein_name": "Keratin associated protein 20-24", "gene_name": "Krtap20-24", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCYYGGYYGGLGYGYGGLGCGYGCDYGSYGYGCCRPLCCRRYWSCGFY", "length": 48 }, "evidence": [ { "id": "HGNC:18944", "url": "https://alliancegenome.org/gene/HGNC:18944#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BIG3-1", "protein_name": "Keratin associated protein 20-21", "gene_name": "Krtap20-21", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCYYGGYYGGLGYGYGGLGCGYGCGYGCGYGGYGYGCCRPLCCGRYWSYGFY", "length": 52 }, "evidence": [ { "id": "HGNC:18944", "url": "https://alliancegenome.org/gene/HGNC:18944#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A087WQL6", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6" } ], "pmid": "" }, { "name": "intermediate filament", "id": "GO:0005882", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005882", "evidence": [ { "database": "UniProtKB", "id": "A0A087WQL6", "url": "https://www.uniprot.org/uniprotkb/A0A087WQL6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A087WQL6-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 57, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A087WQL6-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A087WQL6" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }