{ "uniprot_canonical_ac": "A0A077KA19-1", "uniprot_ac": "A0A077KA19", "uniprot_id": "A0A077KA19_MOUSE", "mass": { "chemical_mass": 35676.0, "monoisotopic_mass": 35676.0 }, "refseq": {}, "gene_names": [ { "name": "Cd200l2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19", "id": "A0A077KA19" }, { "name": "Gm17783", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19", "id": "A0A077KA19" }, { "name": "isec2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19", "id": "A0A077KA19" } ], "protein_names": [ { "name": "CD200 molecule like 2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19/entry#names_and_taxonomy", "id": "A0A077KA19" }, { "name": "ISEC2 protein, intestinal secretory cell protein 2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19/entry#names_and_taxonomy", "id": "A0A077KA19" } ], "function": [], "disease": [], "snv": [ { "evidence": [ { "id": "rs50312079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs50312079" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 198, "end_pos": 198, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->IIS).", "chr_id": "16", "chr_pos": "45347943", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N198", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs244622686", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs244622686" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 286, "end_pos": 286, "sequence_org": "Y", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YKT->NKT).", "chr_id": "16", "chr_pos": "45332317", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y286", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Cd200l2", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19", "locus": { "chromosome": "16", "start_pos": 45332154, "end_pos": 45352413, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000116542", "url": "https://www.ensembl.org/id/ENSMUSG00000116542" } ] } } ], "crossref": [ { "id": "MGI:5009947", "url": "https://alliancegenome.org/gene/MGI:5009947", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSMUSG00000116542", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000116542", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05846", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05846", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033321", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033321", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "5009947", "url": "http://www.informatics.jax.org/marker/MGI:5009947", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "TWQKIQN", "url": "https://omabrowser.org/oma/group/TWQKIQN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A077KA19", "url": "https://www.orthodb.org/?gene=A0A077KA19", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46841", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46841", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46841:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46841:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A077KA19-1", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDFLLHCILHLLMLPPCAQESGSLQRIRHKNYETAVLGRNVTLFCNFSSLANVLQITWQKIQGSLPHNIGTYSHTYGEKILPPYVNRLQCKTLEPSASFMTIQGVTFEDEACYKCLFNIFPRGSHGGQTCLTILTVSELVTELQSAPGSEDLHSLLCSAVGKPAPGISIYPSQVTVQAPQEYFVQNANATVTVTKIYNISLKTARSLGLQNLVVSMTHPVRNEEKIVHLPVNQGGTTNPCLNWMITAIAFIILFFVSCIISAVLYIYFQKKRSEKVPKPSPTQDPYKTSTLMPPPPSTESENLITHTTRQILEVYMFLCH", "length": 320, "header": "tr|A0A077KA19-1|A0A077KA19_MOUSE Isoform 1 of ISEC2 protein, intestinal secretory cell protein 2 OS=Mus musculus OX=10090 GN=Cd200l2 PE=1 SV=1 CANONICAL=A0A077KA19-1" }, "isoforms": [ { "isoform_ac": "A0A077KA19-1", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19/entry#A0A077KA19-1", "sequence": { "sequence": "MDFLLHCILHLLMLPPCAQESGSLQRIRHKNYETAVLGRNVTLFCNFSSLANVLQITWQKIQGSLPHNIGTYSHTYGEKILPPYVNRLQCKTLEPSASFMTIQGVTFEDEACYKCLFNIFPRGSHGGQTCLTILTVSELVTELQSAPGSEDLHSLLCSAVGKPAPGISIYPSQVTVQAPQEYFVQNANATVTVTKIYNISLKTARSLGLQNLVVSMTHPVRNEEKIVHLPVNQGGTTNPCLNWMITAIAFIILFFVSCIISAVLYIYFQKKRSEKVPKPSPTQDPYKTSTLMPPPPSTESENLITHTTRQILEVYMFLCH", "length": 320, "header": "tr|A0A077KA19-1|A0A077KA19_MOUSE Isoform 1 of ISEC2 protein, intestinal secretory cell protein 2 OS=Mus musculus OX=10090 GN=Cd200l2 PE=1 SV=1 CANONICAL=A0A077KA19-1" }, "locus": { "chromosome": "16", "start_pos": 45352350, "end_pos": 45332213, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000232600.2", "url": "https://www.ensembl.org/id/ENSMUST00000232600.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000155928.2", "url": "https://www.ensembl.org/id/ENSMUSP00000155928.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IYNISLK", "relation": "attached", "comment": "", "start_pos": 198, "start_aa": "Asn", "end_pos": 198, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn198", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" }, { "id": "GLY_000889", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000889" } ], "filter_code": "00100000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxx.xxxxx.xxxxx" } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Deep quantitative glycoproteomics reveals gut microbiome induced remodeling of the brain glycoproteome", "journal": "bioRxiv", "date": "2023", "authors": "Potel C.M., Burtscher M.L., Garrido-Rodriguez M., Brauer-Nikonow A., Becher I., Typas A., Zimmermann M., Savitski M.", "evidence": [ { "database": "GlyGen", "id": "GLY_000889", "url": "https://data.glygen.org/GLY_000889" } ], "reference": [ { "type": "DOI", "id": "10.1101/2023.09.13.557529", "url": "https://glygen.org/publication/DOI/10.1101/2023.09.13.557529" } ] }, { "title": "Modernizing reference genome assemblies.", "journal": "PLoS Biol.", "date": "2011", "authors": "Church Deanna M, Schneider Valerie A, Graves Tina, Auger Katherine, Cunningham Fiona, Bouk Nathan, Chen Hsiu-Chuan, Agarwala Richa, McLaren William M, Ritchie Graham R S, Albracht Derek, Kremitzki Milinn, Rock Susan, Kotkiewicz Holland, Kremitzki Colin, Wollam Aye, Trani Lee, Fulton Lucinda, Fulton Robert, Matthews Lucy, Whitehead Siobhan, Chow Will, Torrance James, Dunn Matthew, Harden Glenn, Threadgold Glen, Wood Jonathan, Collins Joanna, Heath Paul, Griffiths Guy, Pelan Sarah, Grafham Darren, Eichler Evan E, Weinstock George, Mardis Elaine R, Wilson Richard K, Howe Kerstin, Flicek Paul, Hubbard Tim", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19" } ], "reference": [ { "type": "PubMed", "id": "21750661", "url": "https://glygen.org/publication/PubMed/21750661" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JVP3-1", "protein_name": "CD200 molecule like 1", "gene_name": "Cd200l1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDFSLLCVTHLLMLPLCAQESESSQRIKYNTFETAVLGGNVTIFCNFTSLANVEQITWQKIQGSLPHNIGTYSHKYGEKILPPYINRLQCKILEPSASFMTIQGVTFEDEACYKCLFNTFPQGSHGGQTCLNILTVSELVTELQSVSGSEDLQNLQCSAVGKPAPGISIYPSQVTVHPAQEYLAQNPNATVTVTKSYSISLKTARSLGLQNVVVSMTHPVRHEEKIVPLPRNQGGTTNSCLNWKITATIFIILFLISWIIIGALRFIHFKKKRSENTPEPSSTQTPNPLSTLVPTPPSTETDNLMRHRRQTET", "length": 313 }, "evidence": [ { "id": "A0A077KA19", "url": "https://omabrowser.org/oma/group/A0A077KA19/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A0G2K2J5-1", "protein_name": "CD200 molecule like 2", "gene_name": "Cd200l2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDFLLHFSLHLLLLPLCEQESESSQRIKHKNYETAILGRNVTIFCNMTSLADVLQVTWQKIQDSSPHNIGTYSHKYGERILPPYVNRLRCKLLEPSASFMTIQGVTFDDEACYKCLFNTFPHVSHGEQTCLNISTVSELVTELQSVPGSEDLHSLRCSAVGKPAPGISIYPSQVTVHPAQEYLVQNSNGTVAVTKIYSISLKTARSLGLQNVVVSMTHPVRHEEKIVPLPGNQGCTTNPCLNWKITATVFIILFLISWIIIGAHCYIHFKKERSENLPEPSPLQMSNTIPTLIPTPPTKETENLISQHHQTDLIGSM", "length": 317 }, "evidence": [ { "id": "MGI:5009947", "url": "https://alliancegenome.org/gene/MGI:5009947#orthology", "database": "AGR" }, { "id": "RGD:1590252", "url": "https://alliancegenome.org/gene/RGD:1590252#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-060503-356", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-060503-356#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A287AS78-1", "protein_name": "Ig-like domain-containing protein", "gene_name": "LOC100517427", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MGFPLHPIIQLLMLPLWVQGSGNLHRIKHNNNETAVLGENVTIFCNLTTPADVMQITWQKIQDSLPQNIGTYSSKYGEKILPPYTDRLHCEAIEPNSSFITIREVTFEDEACYKCLFNVFPHGSHGGQICLNIITVSELRTELQSNLDSEDFLRFTYSAVGKPAPQISLFPLQILMNPPEESLALNPNGTVTITKMYNVSLETVRSLGIQHLIVHMDHPLRNEEKIIPLSVKQECTAGFSYNWLPKVGAFITVLCSSFIIICIIQRKKKFYRREHMDFRQLVGRRPLGGEKKAEIGNLK", "length": 299 }, "evidence": [ { "id": "A0A077KA19", "url": "https://omabrowser.org/oma/group/A0A077KA19/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A8M9PPK5-1", "protein_name": "OX-2 membrane glycoprotein isoform X1", "gene_name": "si:dkey-31e10.1", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MLHLLIALALLRGAYPLEIVARGVTAVVFGQDASLSCILPFASGVKQVTWQRVRAQDVHTLATFSERFKDNVDEDFVGKITFQASFNSTTIEIKNTTFEDEACYICSFKYPTGPKRETLCVTVKGISEITAAVNPADTSDTEVVVSCSATGKPAPTIQWKSREQELKHFRSDDFTTYNKDSSTTVTSNILLLLSQFHGKYVECLAQSDEIERSETIYLPRQQHPDEDASRNYIITFSVLAVIAVVVILITVVFIYCKRKRDRFWLNSSAEKLHDSNEEC", "length": 279 }, "evidence": [ { "id": "MGI:5009947", "url": "https://alliancegenome.org/gene/MGI:5009947#orthology", "database": "AGR" }, { "id": "RGD:1590252", "url": "https://alliancegenome.org/gene/RGD:1590252#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-060503-356", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-060503-356#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "E9Q573-1", "protein_name": "CD200 molecule like 1", "gene_name": "Cd200l1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLLLCAQESESSQRIKHNTYERAVLGGNISIFCNFTSLENVEQITWQKIQGSLPQNIGTYSHKYGEKILPPYVNRLQCKILEPSTYFMTIQGVTFEDEACYKCLFNTFPHGSHGGQTCLTIITVSELVTELRSAPGSEDLHSLLCSAVGKPAPGISVYPSQVTVQAPQEYFAQNANATVTVTKIYNISLKTARSLGLQDLVVSMTHSVRNEEKIVRLPVNQGGTTNPCLNWMITAIAFIILFLVSCIISAVLYIYFQKKRSNNMPEPSSTQMPNPLSTLVPTPPSTETENLMRHHCQSET", "length": 300 }, "evidence": [ { "id": "RGD:1590252", "url": "https://alliancegenome.org/gene/RGD:1590252#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-060503-356", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-060503-356#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P41217-1", "protein_name": "OX-2 membrane glycoprotein", "gene_name": "CD200", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDRGELSQGVQKMT", "length": 278 }, "evidence": [ { "id": "ZFIN:ZDB-GENE-060503-356", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-060503-356#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "regulation of immune response", "id": "GO:0050776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050776", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19" } ], "pmid": "" }, { "name": "negative regulation of macrophage activation", "id": "GO:0043031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043031", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cell-cell adhesion mediator activity", "id": "GO:0098632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098632", "evidence": [ { "database": "UniProtKB", "id": "A0A077KA19", "url": "https://www.uniprot.org/uniprotkb/A0A077KA19" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 188, "end_pos": 190, "annotation": "n_glycosylation_sequon" }, { "start_pos": 198, "end_pos": 200, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" }, { "start_pos": 46, "end_pos": 48, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [ 198 ], "o_linked_sites": [], "snv_sites": [ 198, 286 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 188, "end_pos": 190 }, { "start_pos": 198, "end_pos": 200 }, { "start_pos": 40, "end_pos": 42 }, { "start_pos": 46, "end_pos": 48 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "exact_n_linked_glycan_sites", "count": 1 }, { "field": "exact_n_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "exact_n_linked_glycan_sites", "count": 1 }, { "field": "exact_n_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }