{
    "uniprot_canonical_ac": "A0A077DF94-1",
    "uniprot_ac": "A0A077DF94",
    "uniprot_id": "SPXN2_DANRE",
    "mass": {
        "chemical_mass": 8211.0,
        "monoisotopic_mass": 8211.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "spx2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprotkb/A0A077DF94",
            "id": "A0A077DF94"
        }
    ],
    "protein_names": [
        {
            "name": "Spexin prohormone 2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprotkb/A0A077DF94/entry#names_and_taxonomy",
            "id": "A0A077DF94"
        }
    ],
    "function": [
        {
            "annotation": "Acts as a ligand for galanin receptors galr2a and galr2b.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A077DF94",
                    "url": "https://www.uniprot.org/uniprotkb/A0A077DF94#function"
                },
                {
                    "database": "PubMed",
                    "id": "24517231",
                    "url": "https://glygen.org/publication/PubMed/24517231"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Danio rerio",
            "taxid": 7955,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A077DF94",
                    "url": "https://www.uniprot.org/uniprotkb/A0A077DF94"
                }
            ],
            "common_name": "Zebrafish",
            "glygen_name": "Zebrafish",
            "reference_species": "Danio rerio [7955]"
        }
    ],
    "gene": [
        {
            "name": "spx2",
            "url": "https://www.uniprot.org/uniprotkb/A0A077DF94",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "A0A077DF94",
            "url": "https://alphafold.ebi.ac.uk/entry/A0A077DF94",
            "database": "AlphaFoldDB",
            "categories": []
        },
        {
            "id": "IPR028126",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR028126",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR28590",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28590",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR28590:SF1",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28590:SF1",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF15171",
            "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15171",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "A0A077DF94",
            "url": "https://www.uniprot.org/uniprotkb/A0A077DF94",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A077DF94-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A077DF94-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MISRVWILWTLVLFLLVTESHCIQKSSLSKNWGPQSMLYLKGKHGRRFVPDIDDHFISNSGLKSWYAVFK",
        "length": 70,
        "header": "sp|A0A077DF94-1|SPXN2_DANRE Isoform 1 of Spexin prohormone 2  OS=Danio rerio OX=7955 GN=spx2 PE=2 SV=1 CANONICAL=A0A077DF94-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A077DF94-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A077DF94/entry#A0A077DF94-1",
            "sequence": {
                "sequence": "MISRVWILWTLVLFLLVTESHCIQKSSLSKNWGPQSMLYLKGKHGRRFVPDIDDHFISNSGLKSWYAVFK",
                "length": 70,
                "header": "sp|A0A077DF94-1|SPXN2_DANRE Isoform 1 of Spexin prohormone 2  OS=Danio rerio OX=7955 GN=spx2 PE=2 SV=1 CANONICAL=A0A077DF94-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Coevolution of the spexin/galanin/kisspeptin family: Spexin activates galanin receptor type II and III.",
            "journal": "Endocrinology",
            "date": "2014",
            "authors": "Kim DK, Yun S, Son GH, Hwang JI, Park CR, Kim JI, Kim K, Vaudry H, Seong JY",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A077DF94",
                    "url": "https://www.uniprot.org/uniprotkb/A0A077DF94"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24517231",
                    "url": "https://glygen.org/publication/PubMed/24517231"
                }
            ]
        },
        {
            "title": "Distribution and neuronal circuit of spexin 1/2 neurons in the zebrafish CNS.",
            "journal": "Sci. Rep.",
            "date": "2019",
            "authors": "Kim Eunmi, Jeong Inyoung, Chung Ah-Young, Kim Suhyun, Kwon Seung-Hae, Seong Jae Young, Park Hae-Chul",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A077DF94",
                    "url": "https://www.uniprot.org/uniprotkb/A0A077DF94"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30903017",
                    "url": "https://glygen.org/publication/PubMed/30903017"
                }
            ]
        }
    ],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "extracellular region",
                        "id": "GO:0005576",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A077DF94",
                                "url": "https://www.uniprot.org/uniprotkb/A0A077DF94"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "neuropeptide hormone activity",
                        "id": "GO:0005184",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005184",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A077DF94",
                                "url": "https://www.uniprot.org/uniprotkb/A0A077DF94"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "structures": [],
    "synthesized_glycans": [],
    "enzyme_annotation": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}