{ "uniprot_canonical_ac": "A0A075B697-1", "uniprot_ac": "A0A075B697", "uniprot_id": "A0A075B697_MOUSE", "mass": { "chemical_mass": 12481.0, "monoisotopic_mass": 12481.0 }, "refseq": {}, "gene_names": [ { "name": "Ighv2-9-1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A075B697", "id": "A0A075B697" } ], "protein_names": [ { "name": "Immunoglobulin heavy variable 2-9-1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A075B697/entry#names_and_taxonomy", "id": "A0A075B697" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A075B697", "url": "https://www.uniprot.org/uniprotkb/A0A075B697" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Ighv2-9-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B697", "locus": { "chromosome": "12", "start_pos": 113733470, "end_pos": 113733922, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000095565", "url": "https://www.ensembl.org/id/ENSMUSG00000095565" } ] } } ], "crossref": [ { "id": "MGI:4439519", "url": "https://alliancegenome.org/gene/MGI:4439519", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A075B697", "url": "https://alphafold.ebi.ac.uk/entry/A0A075B697", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000095565", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000095565", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050199", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050199", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "4439519", "url": "http://www.informatics.jax.org/marker/MGI:4439519", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CTEARIH", "url": "https://omabrowser.org/oma/group/CTEARIH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A075B697", "url": "https://www.orthodb.org/?gene=A0A075B697", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23266", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23266", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A075B697", "url": "https://www.uniprot.org/uniprotkb/A0A075B697", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A075B697-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B697-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAVLALLLCLVTFPSCALSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYAISWVRQPPGKGLEWLGVIWTGGGTNYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCAR", "length": 116, "header": "tr|A0A075B697-1|A0A075B697_MOUSE Isoform 1 of Immunoglobulin heavy variable 2-9-1 OS=Mus musculus OX=10090 GN=Ighv2-9-1 PE=1 SV=1 CANONICAL=A0A075B697-1" }, "isoforms": [ { "isoform_ac": "A0A075B697-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B697/entry#A0A075B697-1", "sequence": { "sequence": "MAVLALLLCLVTFPSCALSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYAISWVRQPPGKGLEWLGVIWTGGGTNYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCAR", "length": 116, "header": "tr|A0A075B697-1|A0A075B697_MOUSE Isoform 1 of Immunoglobulin heavy variable 2-9-1 OS=Mus musculus OX=10090 GN=Ighv2-9-1 PE=1 SV=1 CANONICAL=A0A075B697-1" }, "locus": { "chromosome": "12", "start_pos": 113733903, "end_pos": 113733472, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000180013.3", "url": "https://www.ensembl.org/id/ENSMUST00000180013.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000136606.2", "url": "https://www.ensembl.org/id/ENSMUSP00000136606.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Modernizing reference genome assemblies.", "journal": "PLoS Biol.", "date": "2011", "authors": "Church Deanna M, Schneider Valerie A, Graves Tina, Auger Katherine, Cunningham Fiona, Bouk Nathan, Chen Hsiu-Chuan, Agarwala Richa, McLaren William M, Ritchie Graham R S, Albracht Derek, Kremitzki Milinn, Rock Susan, Kotkiewicz Holland, Kremitzki Colin, Wollam Aye, Trani Lee, Fulton Lucinda, Fulton Robert, Matthews Lucy, Whitehead Siobhan, Chow Will, Torrance James, Dunn Matthew, Harden Glenn, Threadgold Glen, Wood Jonathan, Collins Joanna, Heath Paul, Griffiths Guy, Pelan Sarah, Grafham Darren, Eichler Evan E, Weinstock George, Mardis Elaine R, Wilson Richard K, Howe Kerstin, Flicek Paul, Hubbard Tim", "evidence": [ { "database": "UniProtKB", "id": "A0A075B697", "url": "https://www.uniprot.org/uniprotkb/A0A075B697" } ], "reference": [ { "type": "PubMed", "id": "21750661", "url": "https://glygen.org/publication/PubMed/21750661" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A075B5P8-1", "protein_name": "Immunoglobulin heavy variable 2-2", "gene_name": "Ighv2-2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAVLGLLFCLVTFPSCVLSQVQLKQSGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCAR", "length": 116 }, "evidence": [ { "id": "RGD:2323447", "url": "https://alliancegenome.org/gene/RGD:2323447#orthology", "database": "AGR" }, { "id": "RGD:11052040", "url": "https://alliancegenome.org/gene/RGD:11052040#orthology", "database": "AGR" }, { "id": "RGD:11051996", "url": "https://alliancegenome.org/gene/RGD:11051996#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B5Q3-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "Ighv2-5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAVLVLLLCLVTFPSVLSQVQLKQSGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWRGGSTDYNAAFMSRLSITKDNSKSQVFFKMNSLQADDTAIYYCAK", "length": 115 }, "evidence": [ { "id": "RGD:11052040", "url": "https://alliancegenome.org/gene/RGD:11052040#orthology", "database": "AGR" }, { "id": "RGD:11051996", "url": "https://alliancegenome.org/gene/RGD:11051996#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B5Q5-1", "protein_name": "Immunoglobulin heavy variable 2-9", "gene_name": "Ighv2-9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAVLVLFLCLVAFPSCVLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVDWVRQPPGKGLEWLGVIWGGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAK", "length": 116 }, "evidence": [ { "id": "RGD:2323447", "url": "https://alliancegenome.org/gene/RGD:2323447#orthology", "database": "AGR" }, { "id": "RGD:11052040", "url": "https://alliancegenome.org/gene/RGD:11052040#orthology", "database": "AGR" }, { "id": "RGD:11051996", "url": "https://alliancegenome.org/gene/RGD:11051996#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B5Q7-1", "protein_name": "Immunoglobulin heavy variable 2-6-8", "gene_name": "Ighv2-6-8", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAVLALLLCLVTFPSILSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVDWVRQSPGKGLEWLGVIWGVGSTNYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCA", "length": 114 }, "evidence": [ { "id": "RGD:2323447", "url": "https://alliancegenome.org/gene/RGD:2323447#orthology", "database": "AGR" }, { "id": "RGD:11052040", "url": "https://alliancegenome.org/gene/RGD:11052040#orthology", "database": "AGR" }, { "id": "RGD:11051996", "url": "https://alliancegenome.org/gene/RGD:11051996#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B696-1", "protein_name": "Immunoglobulin heavy variable 2-3", "gene_name": "Ighv2-3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAVLALLLCLVTFPSCVLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVSWVRQPPGKGLEWLGVIWGDGSTNYHSALISRLSISKDNSKSQVFLKLNSLQTDDTATYYCA", "length": 115 }, "evidence": [ { "id": "RGD:2323447", "url": "https://alliancegenome.org/gene/RGD:2323447#orthology", "database": "AGR" }, { "id": "RGD:11052040", "url": "https://alliancegenome.org/gene/RGD:11052040#orthology", "database": "AGR" }, { "id": "RGD:11051996", "url": "https://alliancegenome.org/gene/RGD:11051996#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B6A7-1", "protein_name": "Immunoglobulin heavy variable 2-6", "gene_name": "Ighv2-6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAVLGLLLCLVTFPSCVLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLVVIWSDGSTTYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAR", "length": 116 }, "evidence": [ { "id": "RGD:2323447", "url": "https://alliancegenome.org/gene/RGD:2323447#orthology", "database": "AGR" }, { "id": "RGD:11052040", "url": "https://alliancegenome.org/gene/RGD:11052040#orthology", "database": "AGR" }, { "id": "RGD:11051996", "url": "https://alliancegenome.org/gene/RGD:11051996#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A3Q1LLT0-1", "protein_name": "Ig-like domain-containing protein", "gene_name": "", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "VTLICSKMNPLWTLLFVLSAPRGVLSKVQLQESGPSLVKPSQTLSLTCTTSGFSLTSYGVSWVRQAPGKALEWLGGIDSGGSTGYNPGLKSRLSITRDNSKSQVSLSVSSVTPEDTATYYCAKDTVRGSQCEPRQKPPCIGARDHKGAFRTQYTAEPWSRCRRGIGQWGAGGECSSERLFPPIAQEVQLRPSSVSWYFIVVVYVTLRQLCA", "length": 211 }, "evidence": [ { "id": "A0A075B697", "url": "https://omabrowser.org/oma/group/A0A075B697/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "A0A8I5ZUT3-1", "protein_name": "Ig-like domain-containing protein", "gene_name": "ENSRNOG00000064415", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDVLVLLLCLVTFPSCALSQVRLKESGPRLVQPSQTLSVTCTVSGFSVTSYHVSWVRQPPGKGLEWVGAIWKGGSTDYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCAK", "length": 116 }, "evidence": [ { "id": "A0A075B697", "url": "https://omabrowser.org/oma/group/A0A075B697/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A8I6A6J2-1", "protein_name": "Immunoglobulin heavy chain like 9", "gene_name": "Ighl9", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAILVLLLCLVTFPSCALSQVQLKESGPGLVQPSETLSLTCTVSGFSLTSYGVNWVRQPPGKGLEWMGTIWNDGSTDYNSALKSRLSISRDTSKSQVFLKMNSLQTEDTAIYLCARDTV", "length": 119 }, "evidence": [ { "id": "RGD:2323447", "url": "https://alliancegenome.org/gene/RGD:2323447#orthology", "database": "AGR" }, { "id": "MGI:4439519", "url": "https://alliancegenome.org/gene/MGI:4439519#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A8I6ARZ2-1", "protein_name": "Immunoglobulin heavy chain like 3", "gene_name": "Ighl3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAVLVLLLCLVTFPISVLSQVQLKESGPVLVQASETLSLTCTVSGFSLTNYGVIWVRQSPGKGLEWMGIIWGDGNTDYNSALKSRLSINRDTSKSQVFLKMNSLQTDDTAIYYCTRDT", "length": 118 }, "evidence": [ { "id": "MGI:4439519", "url": "https://alliancegenome.org/gene/MGI:4439519#orthology", "database": "AGR" }, { "id": "RGD:11052040", "url": "https://alliancegenome.org/gene/RGD:11052040#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A8I6ATU2-1", "protein_name": "Ig heavy chain V region PJ14-like", "gene_name": "LOC691815", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAVLALLLCLVTFPSCVLSQVQMKETGPGLVQTTQTLSVTCTVSGFSLTSYGVHWVRQAPGKGLEWMGIIWGDGSTNYNSALKSRLSISRDTSKSQVFLTMNSLQTDDTAVYYCAETQ", "length": 118 }, "evidence": [ { "id": "MGI:4439519", "url": "https://alliancegenome.org/gene/MGI:4439519#orthology", "database": "AGR" }, { "id": "RGD:11051996", "url": "https://alliancegenome.org/gene/RGD:11051996#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P01821-1", "protein_name": "Immunoglobulin heavy variable 2-4", "gene_name": "Ighv2-4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAVLVLLFCLVTFPSCVLSQVQLKQSGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCAK", "length": 116 }, "evidence": [ { "id": "RGD:11052040", "url": "https://alliancegenome.org/gene/RGD:11052040#orthology", "database": "AGR" }, { "id": "RGD:11051996", "url": "https://alliancegenome.org/gene/RGD:11051996#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A075B697", "url": "https://www.uniprot.org/uniprotkb/A0A075B697" } ], "pmid": "" }, { "name": "immunoglobulin complex", "id": "GO:0019814", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019814", "evidence": [ { "database": "UniProtKB", "id": "A0A075B697", "url": "https://www.uniprot.org/uniprotkb/A0A075B697" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "A0A075B697", "url": "https://www.uniprot.org/uniprotkb/A0A075B697" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A075B697-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 116, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A075B697-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A075B697" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }